Cool News
Frank Marshall Updates On INDY 5! The Script Is "Progressing"!
Beaks here...
Following up on Shia LaBeouf's tease from earlier this week, producer Frank Marshall has confirmed to Empire that INDY 5 is in development. According to Marshall, "We had a great time making the last one and, as Harrison said, we need to make this one soon. We're not getting any younger."
So, yes, Harrison, Steven and George are all on board for this fifth movie provided they can settle on a script. Marshall says he hasn't heard the "cracked" idea Shia recently spoke of, but he did drop this nugget on Twitter a little bit ago: "The story for Indy5 is progressing. It is still in the research phase."
Though the excuse for making this fifth film is that they all had a blast making the fourth, I hope the true motivating factor is "We're sorry, and we can do better."
-
+ Expand All
-
Eat it, haters. EAT...IT.
-
...but it sure smells good!
-
... I actually kinda liked Crystal Skull. They don't need to make another one. I'll see it, though.
-
Great. I can only hope for more aliens.
-
So another 15 or so years then?
-
I liked the last installment, personally. I had a lot of fun at the midnight showing, and enjoyed what I saw. As long as Shia is kept to a minimum, sweetmeat!
-
FOR WRITING MORE TRASH! ok....okay....maybe that was harsh.FUCK YOU SHIA AND FORD! your film was god-awful! swing on vines? man-eating ants? what the fuck film were you trying to make!
-
they straighten the coat hanger and lie down the varsity jacket for the biggest high school prom back alley dumpster baby abortion since "The Phantom Menace". Oh well. At least they aren't remaking "Bride of Frankenstein".
-
If they've nailed a suitable McGuffin..then get Kasdan in to write it! I love Indy, Crystal was good, but send those Gophers back to Caddyshack, amp up the peril level, and light it the way Doug Slocombe used to, the 1950's Hitchcock look didn't work on the exterior stuff, it looked like a backlot.
-
I liked when he kept getting hit in the crotch by those branches! More of that!
-
You can call it 8 Below, Paul Walker is so hot right now.
-
....you piece of shit.
-
To see for ourselves if it is worthwhile or not. Of all film franchises, this is one that will forever put us in the seats to see for ourselves, and thus will always make buttloads of money. Everyone loves Indy. I, for one, am excited to see it whether it is great or not, it'll be decently fun.
-
Somebody had a great idea that it should be Indy on a field trip with a bunch of students when all hell breaks loose. Don't need Marion or Mutt. Ta Da!
-
How about making a film the audience has fun watching. KOTCS is horrible. I wanted so badly to like it before I saw it. Marshall's comments last year about KOTCS being most like THE LAST CRUSADE were the harbinger of doom though, they really aren't interested in making a great film like ROTLA, they just want to make something light that will do good box office. Which sucks. They aren't young, hungry and trying to do great things anymore. Which is why they aren't.
-
...Indy get a say in this?
-
Where he swims through lava wearing a life preserver.
-
He is poison and was probably responsible a lot of what made Indy 4 shit.
-
you know the gig
-
PLEASE...change the last letter in your name to the letter T.
Then, and only then would I ever watch this train wreck.
And frank marshall? you? there's no hope for you. -
Sorry, but that's my take. Crusade is vastly overrated in my opinion, with an entire first half that is painfully tedious. Only from the Tank sequence to the end credits is this a good INDY movie. My entire family enjoyed Crystal Skull from beginning to end, so I say bring on a fifth helping!
-
...is that KOTCS made lots of money. Though neither Lucas or Spielberg are exactly suffering from a cash shortage. News of a 5th Indy movie moving forward is nothing but depressing to long-time fans. It certainly doesn't fall under "Aint-it-Cool" news...
-
Next time ask him why he went into hiding following the 'Twilight Zone: The Movie' tragedy. Also try and find out how much Spielberg knew about what Landis was up to.
-
Just like Indy 4 it reminds him of going to the movies and seeing the original and that aparrently is enough to give a positive review to a complete piece of shit movie.
-
Speak for yourself. INDY 4 ruined it. I just don't care anymore about the continuing adventures of these characters. RAIDERS and parts of TEMPLE OF DOOM are more than enough.
-
I wonder what fucking retarded suckfest Spielbitch and LucASS concoct this time...as if it weren't enough that Spielberg's mother called me a "fat kike" when I went to her restaurant in Los Angeles, now we're faced with "Shia of the Apes Part 2"...maybe this time he'll dive with the walruses. That would be aw...ful!
-
It was the best time I've had in theaters in years. It's going to be tough to outdo. Indy 4 was by far the greatest film to come out of summer 2008.
-
and he's coming back!..
-
Indy rules and so did KOTCS.
-
movies dont make nearly 800 million dollars worldwide based on single viewings. many people saw it and many saw it multiple times, most people did in fact enjoy it. i know i know, here comes "well i dont know anyone who did" or whatever the hell that line is. but those who didn't like it are in a very tiny minority. oh and i know, "then they dont have brains or taste" or whatever other line is usually used. the geek crowd that seems to have such amazing taste that nobody else shares is such a small part of the overall. not saying those who hated it are wrong, its your opinion but stop acting like your opinion is fact or something. and making another movie because they had fun sounds like a great reason to me, why make movies if you dont enjoy yourselves?
-
...was unbelievably horrid. I had to fast forward to the aliens. One of those movies where you're like, "How in the blue fuck did this get past the storyboards?"
-
1. Land of the Dead
2. Kingdom of the Crystal Skull -
Go suck Lucas' non-existent man-penis somewhere else, you troglodyte!
-
... Ask him what it's like to be married to a piece of shit like Kathleen Kennedy. I suppose the dead-eyed cunts deserve each other.
-
I jsut ate a lean cuisine pizza...and it's "progressing".Soon, it will be a ripe turd, much like your vision of the next indy film FRANK! and guess what frank? mINE'S FREE!
-
Honestly i really don't know why everyone hates Shia. The man is a good actor, it's not his fault that he did what he was told. It's the writers and the director who are to blame. I mean if you were offered a part in one of the best franchises ever by one of the greatest directors ever, wouldn't you do what they asked? Anyone who says they wouldn't is a dirty Nazi liar
-
"Go suck Lucas' non-existent man-penis somewhere else, you troglodyte!" Me wonders, what other penises are there besides your so-called 'man-penis'?
-
still rocked!..That shot of Indy looking at the mushroom cloud..so cool!..Indy entering the Atomic Age!
-
Seriously! It wasn't the best, but I enjoyed it. I still think Atlantis is a natural fit, or Noah's ark.
Some people will always find something to bitch about. -
...it's friggin' Indy for cryin' out loud. The next wil rock as well and the haters will loathe it with a passion, just like they did with KOTCS.
-
Have YOU tasted RICH KELLY'S TASTY JELLY(tm) yet? IF Not, you best go get some you silly motherfucker
-
is to make the age difference between the first three and the forth not so prominent.
-
..there should be excitement! Anticipation!..waiting for the tidbits about who else is gonna be in it..whats the story..etc..thats half the fun
-
I second that. Indy4 was utter crap.
-
...and protest this shit. Why do they have more balls than we do? They wouldn't stand for this... DEATH TO SHITTY INDY MOVIES!! Who's with me?...anyone?
-
something good will come out of this. I'd hate for the series to end on such a low note.
-
Since Hollywood loves to do remakes now, just remake the 4th film and fire Lucas and the effects people who gave us the awful CGI effects.
-
Srsly.
-
Maybe early shades of Viet Nam?
-
Michael Bay's already got an erection just thinking about it.
-
...good post..i dont understand the hate..(Especially torwards Lucas and Spielberg)
-
...progressing down the large colon, shortly to be squeezed out at a theatre near you. Final proof that while the fans made them rich, Spielberg and Lucas want us to know that they hate us.
-
...and I'm willing to bet most of them own a copy of Indy 4 on DVD or Blu-Ray.
Indy 4 = Greatest film of 2008 -
Another one? Why? Are they really going to try and force Mutt Williams down our throats as a new Indy franchise?
-
Bay has promised not to make any more shit Bayformers movies: http://tinyurl.com/lrf9nb
-
Twitter is fucking news now.
-
It's fashionable and interesting to hate. Nothing beats a good backlash. I just like Indiana Jones, and will see the next one and the one after that. After that, I will buy them on blu-ray and watch them when I want to have a good time. That's what Indy is for, to have a good time, to enjoy yourself and all Indy movies have done that for me. If that makes me George Lucas' bitch or Steven Spielberg's talking puppet so be it.
-
the name alone speaks volumes.I say crap it all together and make a nice epic film about RICHARD KELLY'S TASTY JELLY(tm).A story of triumph, and one's man journey of "making" it in hollywood, only to be trashed for making awful films-and then finding TRUE fame and fortune..by making Jelly.I'd see that!
-
As long as there are people out there dumb enough to pay to see it, why not make it and cash in? It worked for the last one.
-
... Frank Marshall cries himself to sleep every night. He's already boned Kathleen Kennedy in her no doubt diseased slack vag but even that's not enough of a punishment for this absolute cunt of a human being.
-
Strap-on's and hermaphrodites!
-
As much as I did enjoy a new Indy film last year, for IJ5, make it about Indy. In Raiders, Marion and Sallah came and went throughout the film, while Indy took care of business with the Nazis. In IJ4, how many sidekicks did Indy collect? 4?! That is way too many and they all required screen time so it ended up diluting all of the characters. For me, IJ works best when it is one guy at war with the Nazis (or I guess Soviets now) while spreading mayhem and chaos.
But, we may never see Indy 5 if it takes another 19 years to get a fifth installment into theatres. -
is how much Indy 4 grossed worldwide...not counting DVD, toys, merchandising etc.
-
There are some real scum on here. You know who you are.
So far as i'm concerned Spielberg, Lucas and Ford can go on making Indy films til they drop. A subpar Indy film is 99% better than the Hack Pack shit we've been shovelled since around 1996. -
The poor woman needs the work.
-
But if there were a Jehovah/Yahweh/Allah/Santa in Heaven, we'd be getting another JP movie (actually if that series had stayed on-track, we'd have gotten JP5 this summer), Indy 4 would have been written by Lawrence Kasdan, we'd all be unaware of Shitty LaBeef's existence, and Indy 5 would actually have a hope in hell of being decent.
-
Fucking Lucas. Indy 5 should help him build that exact replica of Hearst Castle in Marin County. Very fitting, considering that he is now Charles Foster Kane.
-
Thanks for the laugh!
-
Is he gonna work on Ghostbusters 4 next?
-
set the film in Germany post WW2 as Indy tracks down some relics before the Russian to gets them
-
Even in the movie business, it is all about supply and demand. If the fans don't show up for this crap, they will stop making them. If you enjoyed Indy IV, and want another average sequel, then so be it. If you are expecting another Raiders, just like you expected another Empire during the Prequels, you are setting yourself up for a disappointment. As long as these movies keep making big money, then they will keep making them.
-
I liked Crystal Skull, but even if you didn't that doesn't mean Indy 5 can't be better (or worse for that matter). I remember people calling for an end to the series after TOD. I say keep 'em coming.
-
Not a chance.
-
Going back to a franchise at this late date needs to be a throwback--the little peak at the ark at area 54 could have been its own movie. A return to the chamber with the idol from the first movie--a prelude involving a young Indy and a young Belloch. I like the idea of the ark, busted out during Crystal Skull, has a fresh role to play . . . Whatever it is, I'll see it. Even with Shia LaBeef.
-
I wonder if anyone has ever found it odd that after Spielberg was strong armed by Warner Bros. into finishing Twilight Zone the movie, that he signed a multi picture deal with Warner Bros. (the company that payed settlement money related to Vic Morrow and the children's families). And a couple of years later Landis did Spies Like us with Warners. You'd think Warners wouldn't have wanted anything to do with Landis, and Spielberg wouldn't have wanted anything to do with Warners.
-
Complete the circle. That's what number 5 oughta be about.
-
Shia LaBeouf Claims Steven Spielberg Has "Cracked The Story" For INDY 5 - 1142 total posts
INDY tb's are like buses, you wait ages for one then two come at once. -
lucas must be stopped
-
Which INDY tb will win on total posts though?
'Shia LaBeouf claims...' or 'Frank Marshall updates...'?
Place your bets ladies and gents. Place your bets.... -
Looks like I'm getting me some Indy 5, and that's all that matters.
See you in hell! Good day. -
Raiders is as near a perfect adventure movie as has ever been made, but all 3 sequels have glaring flaws. You forgive Temple's and Crusade's bullshit because you saw them back in your youth when your biggest worry was finding a time to jack off without mom walking in. Now you deride Skull for the same silly shit because the rigors of life sucked all the joy out of your existence. The 3 Raiders sequels all have stupid shit that makes you groan, but they're all fuckin fun as fuck. Just kill yourself now if you've lost sight of that.
-
Somebody has to start with the lame age jokes.
-
Was John Williams score. Each of the past films had memorable scores. Crystal Skull's score was undistinguished. I don't blame Williams too much though, because after what Lucas did to his Prequel scores, he probably didn't even fell like putting in too much effort in case it happened to get hacked to bits.
-
And Raiders and Temple of Doom made two great, very distinct movies, where as Last Crusade was kinda "meh". I'd probably put Crystal Skull above Last Crusade.
-
ToD and LC did not have cgi chipmunks and cgi monkeys swinging on vines. Was there silly shit, sure. Was there lame- assed teletubby type shit. No!
-
but I can't forgive Indy playing second fiddle to about 10 other characters in Crystal Skull. The last Rambo may have been schlock, but at least Rambo got to be the focus of the film.
-
Bother me more than the gophers and the monkeys in Crystal Skull.
-
Can I bring that chestnut back? That was a hoot!
-
Look, I love humor, but Indy 4 was just too silly at times. I want to feel like Indy in danger like the first three.
-
For the best movie reviews, who better to ask than to people wihtout jobs who just watch films. Subscribe at itunes and look for "jobless film reviews" or go to http://tinyurl.com/l44edq
-
Jun 18, 2009 3:38:30 PM CDT
Frank Marshall is a pimp, what I did not know until this day
by yackbacker
Was that it was Spielberg all along!
-
how to swing on vines and so that he catches up to vehicles going at least 60 MPH. In what universe is that not completely riduculous. George of the jungle had more realism than that.
-
The Young Indiana Jones TV show tanked, no he's having the whip be passed to Indy's son. Sort of backdoor Young Indy story.
-
As ghosts in Indy 5. Maybe they're going with the abandoned haunted castle concept for Last crusade.
-
Rubber animals actually fit with the whole original idea of Saturday matinee serials. And are still far more realistic than cgi monkeys teaching a human how to swing on vines in order to catch up to speeding vehicles.
-
Shill your crap elsewhere, fuckface.
-
At the very least the action sequences should be shot old school. CGI should only be used when something magical or supernatural is happening like wrath of God Nazi face melting.
-
Jun 18, 2009 3:44:52 PM CDT
I swear to Heaven, if Lucas wants to "rework" this script, now..
by yotzvonfrelnik
The last one was scripted by Frank Darabont, I believe, correct me if I'm wrong... and it was kick-ASS from what Harry and others said. Then Lucas kind of Hmmm'ed over it and decided it needed a li'l more work. And the rest you saw.
-
That thing looked like the puppet from the Masters of the Universe Slime Pit playset. And the wooden rhino looked like Supersonic Man would pick up.
-
What you saying dog? I think I follow you. It is definitely peculiar that WB wanted anything to do with Spielberg and Landis. Don't for a moment think that Spielberg wasn't aware of what was going on with Landis' section of the film. Spielberg was protected by Marshall and to a lesser extent Kennedy. They went out of their way to distance Spielberg from the tragedy and Landis. Does it really seem likely that Spielberg was entirely in the dark regarding what was going on with a film he was producing? Marshall was the one person who was involved with Landis' portion of the film and also the one person who knew exactly how much Spielberg knew about Landis' antics (circumventing child labor laws, putting kids next to 100 foot high explosions and 20 feet below fucking helicopters). This is why Marshall, at Spielberg's behest, fled the fucking country for years. By being out of the country he couldn't be questionned by investigators, wouldn't be involved with the trial, etc. Perhaps the WB deals came about by way of a deal wherein everybody would keep quiet or something like that. Who knows? All I know is that Frank Marshall disappeared in the early hours of the day following the accident and didn't really return to the country until after the trial was over. Why? Just to save his own ass? Or was it to save Spielberg's too? It was Spielberg who had Marshall all over Europe scouting locations for Temple (and I half-think that Roger Rabbit was made in England purely so Marshall could be out of the country (He was over there doing prep in June of 86) at the exact time of the trial though I accept that this is a bit of a leap). Wouldn't it have made sense for Marshall to stick around and clear both his name and Spielberg's name if they were indeed innocent? That said I'm not sure anyone would believe that Spielberg was involved. I think even at the time it was just assumed that Spielberg had nothing to do with any of this, even before anyone had looked into it. He made ET for fuck's sake, right? He loves kids, he's a great guy, he's like a big kid, etc. This is why nobody gave it much thought at the time and why nobody seems to be asking these questions these days. But I've always thought that there was more to it. I could write something less rambling if it wasn't for this ridiculously small and non-user-friendly comments window but hopefully there's some food for thought here. Removing the Spielberg allegation entirely the fact remains that Frank Marshall was quite heavily involved with something that resulted in the deaths of three people.
-
the part with the dodgy rubberhead!~
-
"I can do better". The reason for Harrison Ford is "I made $65 million off Indy 4, which is more than I made in the entire decade before". The reason for Lucas is unknown... Indy 4 was such a disappointment. Indy 1 remains the greatest action movie ever made (and I'm gonna see it in theaters again monday :)
-
It's markedly BETTER than what we ended up with, but it had huge problems too. For one thing, the fucking movie would've been four hours long.
-
Frank sonofabitch Marshall goes out Elvis style.He's Right bout to phone speilberg, and is writing some alst mniute dialogue on his working copy of the enw script, and bam! his pathetic heart whimpes out and the script falls into the toilet(thankfully)..and thus ends this whole friggin debaucle.
-
I don't get why we have to go back to toy models and paintings. If they use it well, no one notices, like in the new Star Trek, or Jurassic Park.
-
If they jettison Lucas and his dirty fucking penchant for CGI and "Awww shucks" moments, ditch LeBoeufencroute, get rid of DCI Slater (there's a reference for you)and set it in mid-fifties Argentina with Indy and a grown up Short Round trying to find something while pursued by the local hiding Nazis. No collaborations, no large list of sidekicks, no swinging on vines and NO FUCKING CGI. Go back to bluescreens, models and a bit of fucking movie magic, if I want a computer game I'll turn on my 360, thanks.
-
make a green screen cgi broom closet and lock lucas in it.
-
I always thought Spielberg was either there the night of the helicoptor accident or at least had knowldege through Marshall about what was planned (dangerous effects shot involving children). I don't believe that he was totally in the dark (considering what a control freak he was around that time/Poltergiest Tobe Hooper incident). My belief is that he knew what was going on, Warners/Landis knew this, and they forced him to film his segment (which by all accounts he didn't want to do), and into a multi-picture deal (which Warners had the most to benifit since this was post E.T.). I think there may have been some kind of blackmail going on on the part of Warners, but there is no proof other than how the business events played out post accident. As I stated above, this is not fact, just my opinion.
-
between Indy and the snake than a fucking cgi snake any day of the week, thank you very much!
-
Harrsion Ford unzip his pants and reveal he has no penis than ....ah..fuck it
-
Jun 18, 2009 4:02:39 PM CDT
I don't care what people say Indy 4 was awesome!
by theyreflockingthisway
I loved it, it was a great adventure and I'd rank it above Crusade but below Raiders.
We got to see things I always craved more of in the earlier films. This was a film with lots of exploration of old ruins like in the opening sequence of Raiders. In the previous films the only times Indy did that was at the start of Raiders and at the end of Crusade. I always found that part of Indy to be the most interesting and it's the main reason I loved Crystal Skull.
There are lots of other things I love about the film too - I just thought it was fantastic from beginning to end and I can't understand why some people rate it so low.
I know some people will call me crazy for this but I don't care. To me it was as great as the old films and I'm sorry some other Indy fans didn't see it the same way. I really hope the people who worked on the film are not sorry for the film - I hope they're proud they've made a film so many love (if not online). -
At CatVutt is right: Darabont's version wasn't that great. Hell, I'm not even sure it was "good."
-
was more realistic than the cgi gophers in Crystal Skull.
-
...search for El Dorado, Shangri La, or Atlantis. All of which have unfortunately been done by other movies, now. Too late, Lucasberg. The sci fi angle was a terrible idea. And for the love of god, PLEASE no CGI-assisted vehicle chases. Lets stay with locations and practical FX for this one.
-
you're a dirty baby murderer, and you smell like cabbage. And your idea of a good time is giving Harrison ford a SHINY chest and covering shia in leather.
Seriously man, what the FUCK is wrong with you? -
same thing the last one suffered from. script problems that went on for about 10 years. Therefore this one will be out around 2019. And Harrison will be pushing it then...
-
Jun 18, 2009 4:08:34 PM CDT
Shia....do the right thing...go out like Chris McCandless.
by dannyglovers_dickblood
Society has no use for you.
-
"search for El Dorado...All of which have unfortunately been done by other movies". Yeah, like Crystal Skull, remember?
-
Die in a fire you raging spamcunt!
-
Spielberg's mother called you a "fat kike"?
I must hear that story. -
Screw this attitude that they have to atone for anything. What a bunch of self important nonsense. The movie was fine and sits comfortably with the others as far as I'm concerned. Honestly if you people are really going to stick to your guns you'll stay away regardless of what form this takes (even though you want a 3RD film with Nazis, a Judeo Christian quest and a desert setting).
-
It's just not Indiana Jones without them.
-
They'll be 80 before they do anything else with Indy.
-
But then ends up shacking up with Bristol Palin.
-
Jun 18, 2009 4:15:05 PM CDT
The 5th one will probably be a remake of Last Crusade
by lockesbrokenleg
Will they bring back Marion, or kill her off?
-
That's what it sounded like to me! When I was a freshman in high school, I was visiting family in LA, and one of them suggested going to Leah Spielberg's restaurant, knowing I was a huge fan of her son's. Halfway through the meal, Leah cam over the table to ask how everything was, and I couldn't resist telling her how much I loved her son's movies...she got this weird look on her face, and said something about "I don't have the time", and hurried way. And as we were leaving, we passed her at the front of the restaurant, and she mumbled under he breath that sounded like "fat kike"! And I wasn't even overweight in high school! The woman's obviously a raving anti-semite. I know it was obnoxious for me to say, and she probably hears it constantly, but still, it was mean.
-
Indy movies should be dusty and dirty. Lazy fucks should shoot on location. There's no room for spontaneity when it's all pre-vis and CG.....
There were a couple cool bits in Indy 4, but I'd say that (unlike most talkbacks) most of the criticisms here are spot on.. too many characters, too much silly shit, and not enough cool shit for indy to do.... I hope they go back to the roots for the last one. If they focus on Indy and Mutt maybe they can strip down and make an awesome sequel to the greatest action movie ever..Raiders -
them to set 5 before 4 in the timeline, like TOD. Then they can bring back Henry and dump Mutt.
-
Yes, tell the Bearded One that Buzz Maverik will write the screenplay for INDY V for free. I figure, if a good movie is made from it, it'll get me writing gigs that pay. Either way, it'll make for a good interview story.
-
Argg, we don't need another Indy Movie.
-
will actualyl star FRANK MARHSELL and be written by Harrison Ford. Frank will forever me mocked by children, and the metnally handicapped.Frank, maybe its time you sat the fuck down, shoved a spoonful of RICHARD KELLY'S TASTY JELLY(tm) and chill the fuck iout
-
Shia's really not that bad. The greaser angle and the diner fight was pretty cool.
-
Because now there can be more episodes of South Park where Lucas and Spielberg rape Indiana Jones!!!
-
Setting before 4 is a great idea, I want to see Indy as a spy in germany and russia
-
Stabby, mechanical gopher - true, light flare on glass better than cg - true, Josh Holloway to take over as Indy - true.
Bale be praised. A zero bullshit tb'er. -
Were you riding a motorcycle? Maybe she said "phat bike"? :)
Seriously, that's bizarre. She's a Jew, her son makes a movie about the Holocaust... and she calls people "kikes"?
Amazing if that's what she actually said. -
...for some reason. I agree, make it a prequel, four or five years before KoCS. Start with a prologue in World War II that could jump-start the plot. Dump Marion and Mutt, and have it focus on Indy, and a much younger British historian (a Rachel McAdams or Elizabeth Banks-type) he picks up on his travels. Also, have a former student of Indy's who's now a full professor, who will start as a pain-in-the-ass competitor and end up in a love triangle with Indy and the British girl. The bad guys would be a Communist Chinese Colonel played by Chow Yun-Fat, (or a reasonable facsimile), Wan Li, (AKA, a grown-up Short Round, played by a Jackie Chan-type, who ends up saving Indy at the end), and a mysterious European nobleman played by Jason Isaacs who's actually the last in a line of ancient Viking religious-sect leaders, who uses a grotesque instrument to suck people's brainstems out of the back of their necks in order to retain their recent memories. Jason Isaacs wants to bring about the end of the world, Ragnarok, according to the ancient Norse prophesies, where only his follows will survive and he will be ruler. Throw in Charles Dance as a seedy English expert in the occult underground, with a cameo by Sean Connery, set it in London, Jamaica, and Siberia, and keep the CGI chipmunks and monkies away from it, and for Serling's sake, if George rears his passive neck, tell him to piss off!
-
I hate Indiana Jones and the Kingdom of the Crystal Skull? Is it because it's fashionable? Then why don't I hate everything? Why didn't I hate Star Trek or TDK?
That's bogus and convenient. -
Was perhaps the most overhyped film in my life time. My god, what a POS. Can you believe it pulled off a 76% on rottentomatoes? Even the critics were fooled by this thing. The only way I'm spending $ on this next film is if Lucas is hands off. I also suspect that's the only way Steve's going agree to direct it. The Indy sequels have never been perfect and I think they can still salvage the saga, but they've got to put their foot down as far as Lucas's involvement is concerned.
-
Where going to take it up a notch in Indy 5. In between scenes, Harry and Shia are going back to the trailer for some opium smoking, and some hardcore ass ramming.
-
I was mostly joking...that IS what it sounded like to me at the time, but I doubt it's what she said, for the reasons you've pointed out. ;)
-
I have it on good authority that Spielberg once actually pissed on some members of his staff. This would've been in the late eighties/early nineties. Also Capshaw used to threaten to commit suicide fairly frequently as a way of getting attention. They're pretty fucked up human beings all told.
-
TDK and Star Trek were "fashionable to like" - then why didn't I hate Speed Racer?
-
Frank M. is a pole-smoker.
-
The early 90's? He didn't piss on Jeff Goldblum, did he? Because if so, it was probably because Jeff was watching him poop...
-
Indiana stumbles upon the cursed Aztec gold, and discovers that he can't die. He also finds an ancient band of undead pirates. Johnny Depp co stars.
-
Jun 18, 2009 4:31:26 PM CDT
One of the biggest problems with Indy 4: too much CGI. WAY too m
by mike_d
these films are supposed to be a throw back to the 30s serials. Low-budget, practical effects. I felt like I was watching a cartoon when I saw Indy 4.
-
Focus on Harrison Ford. It's his character and, no doubt, his swan song for the series. Do all of this... and I have no problems laying down my money for another adventure.
-
The Whiny Autofellationers Who Will Still See It Opening Night
-
...was total shit. Nothing, NOTHING, is as stupid as that flying fridge scene. Just thinking about it as I write makes me angry again.
-
Speilberg: put in some effort this time!
-
Staff as in maids and so on. Maybe Goldblum got splashed if he was there.
-
It was lazy and forgettable. What a waste of talent and resources....
-
thats progress!
-
...I beg them to make the bad guys Anti-Communist Americans. That was the one moment in Indiana Jones 4 that had promise. Soviets are so boring, but CIA McCarthy-ites are genuinely intimidating since they're, you know, us.
-
Oh No,another fuckin shitty Indy movie(cant believe I just said thatIndy 4 was the biggest piece of shit Ive ever seen,from the Nuked fridge,to the gophers,to Tarzan Shia,to CGI everything,to fuckin aliens.Everything about Indy was horrible....Even John Williams who is the shit.First post ever btw.
-
Is gonna lick balls
-
His script had two things going for it: better verbal sparring between Indy and Marian, and a slightly more coherent conclusion with the aliens. Everything else was the worst kind of fan fiction: recreations of classic Raiders scenes, recycling of every memorable line from Indy 1-3, etc. And if you didn't like the snake gag in Skull, in Darabont's script Indy gets swallowed whole by a 30-foot mutant snake and survives. Shit was fuckin painful to read.
-
I`ll only watch Indy 5 in theatres if it takes place before Indy 4....If not,I`ll rent it or watch it bootleg,which I never do.
-
Giant Transformer-ish Robots are SO hot right now!
-
Where do you cranks come from? Indy 4 best film of 2008? You must be smoking some really good shit. I saw the cgi gopher and my heart immediately sank. My poor girlfriends still in denial. What a confused charmless mess.
-
The rest all have serious problems. Anyone who says Temple of Doom is a great movie is fucking crazy. "chilled monkey brains!" ... There was nothing stupider in KOTCS than that gross out dinner scene, and there was plenty of stupid in KOTCS.
-
we`ll get another great episode from South Park from this.But just imagine Spielberg and Lucas telling themselves"If they thought Indy 4 was bad,then wait till they get a load of the shiny turd were gonna squeeze out this time".
-
...this just makes me want to slit my wrists. There are thousands upon thousands of books out there the studios could adapt... there are thousands of original spec scripts...yet we're doing another freakin' Indy film? Come on!
-
FUCKS SAKE, MAN!!!
-
Indianna Jones and the Hammer of the Gods. They're going North to Iceland, then to Denmark and then to England in search of the Hammer of Thor. It will involve neo-Nazis trying to get a hold of it so they can start the Fourth Reich. (Actually, this not a rumor, I just made it up. I thought it sounded good.)
-
is the only movie to me that has no replay value.I`ll never watch that movie again.I rather watch Terminator Salvation(another abortion)again than watch Shia swinging through vines with CGI monkeys who know who the bad guys are,therefore,attack them.
-
only INDY movie that has no replay movie.
-
Shia, Vines, Gophers, CGI, Rape, Aliens, Childhood.
You people are like drunk relative that won't leave a party. -
replay value.....3 times the charm....FUCK!
-
I for one enjoyed Indy 4. Was it the best of the series? No way and was by far my least favorite of the series but I went into the film with a open mind and not expecting the complete magic from the first three to return because I knew it wouldn't. It's rare for any sequel, especially these days to live up to success of the orignal(s). I think had Indy 4 been the first movie in the series it would've been loved but like the Star Wars prequels it had ALOT to live up to. Such a long way and I think many people were going to be letdown no matter how good the movie would've been. It still has the feel of the original triology unlike the Star Wars prequels (which were all good but like Indy 4 come nowhere near the originals). Indy 4 felt like a Indy movie reguardless of the script or Shia (who is a good actor). If Raiders was made today it probably would've looked more like Indy 4.
-
"Chilled monkey brains" . . . perfect. The dance sequence at the beginning, getting poisoned at the outset and chasing the antidote across the floor . . . awesome movie. I like it better now than when I first saw it in the theater. Not as good as Raiders--almost nothing is--but still a great movie.
-
C'mon Jorge und Steve-do it for the children.
-
Considering Crystal Skull was in development for nearly twenty years, the prospects of this one coming to a theatre near you are pretty slim.
-
Connery and Ford on a quest for the holy grail??
Piss off haters! -
Means we may see another one sooner rather than later, I bet. Ain't none of them getting any younger.
-
Amen.
-
There was no fucking way they would do Indy 4 - and now we're up to this? First of all, where the MOTHERFUCK is Lawrence Kasdan? Second, is insurance company backing up on Harrison Ford? He might be dead as we speak!
-
Jun 18, 2009 5:24:27 PM CDT
Greaaat. Now we get an AICN report every 2 days for Indy5
by future help
for 2 years stright. The magic is dead. let it go. (and if we get surprised, we get surprised...without spoilers to boot)
-
but he did drop this nugget on Twitter a little bit ago: "The story for Indy5 is progressing. It is still in the research phase." WOW!, and the ink is in the pen. and the computer is pluged it. and
money is geing counted. -
The kid and the girl add nothing to the story. Last Crusade was great, and ended the series nicely.
-
How about set this one in the 60's with the the emergence of Dylan, Haight Ashbury etc. Indy smokes some erb, Mutt drops some acid and tells dad to fuck off, Marion gets topless and rides on Indy's shoulders in the park to the strains of Jerry and the Dead. This shit is played.
-
waaahahhahh hahahahhahaaaa
bwwwaaaahahahaaa haaaahahahahaaaaa
jjeeennzzzzneeeerrrrrrrrrraaaaaaahhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh -
HELL MOTHERFUCK NO!
-
Why? They divert from historical fact all the time and did so in the last film regarding some equipment/weapons, I seem to recall. Keep it in the '50s, obviously, but go with Nazis still around in some form in South America, with other globe-trotting to seek the kewpie doll McMuffin/Mcguffin whatever.
-
You can't ruin Indiana Jones. It's inherently cheesy b-movie stuff to begin with. Some of the movies are better than others (Temple of Doom and Crystal Skull were BOTH the weak points in the series). If Temple had been made today, you'd be tearing it a new asshole, even worse than Indy 4... because it's got far more retardation than Skull had. This series isn't the Godfather. The giant rolling bolder, as cool as it looked, was inherently dumb. Marion exploding and then Indy not even bothering to look for a body in the rubble was dumb. There's a lot of dumb stuff in all these movies. Temple and Skull were dumber than most. But it doesn't change the fact that they are dumb movies. They also happen to be wildly entertaining. Give me more. Shut the fuck up. It made sick amounts of money. Clearly normal people don't apply some ridiculously high standard to Indiana Jones that the rest of you fucks do. The joke is on all of you. You never understood Indiana Jones in the first place.
-
...it'll follow the Star Trek pattern of every other movie kinda sucking, with great films in between. Admittedly, they did recognize that Indy 2 was generally subpar (in spite of having its qualities) and Spielberg wanted to film Part 3 as an "apology". Lucas is insane now and there's no changing that, but I'd like to think Spielberg has enough presence of mind to listen to the highly justified criticisms of Indy 4 and LEARN from the mistakes. Namely, don't go with a hack when it comes to the script, get someone like Tom Stoppard. Then, get rid of the cheesy, campy garbage...some lighthearted fun is essential, but don't go overboard. And for God's sake, don't listen to Lucas when he takes it too far.
-
I think theyve both completely lost.Hopefully Spielberg prooves me wrong,but Lucas has definitely lost it and I hope he and his giant fuckin gobble have no input on this.
-
...Kasdan. Or someone else who is clever, like Tony Gilroy. Their choice of screenwriter will tell us loud & cleur whether theyre sorry for Indy 4 or not.
-
what about H.S.M 3....douchebags
-
No, I mean, seriously, read it. Have your people call my people.
-
Everything he touches lately has turned into shit.
-
In his first solo adventure the now college-bound Mutt investigates reports that a local fraternity is hoarding the stolen bones of Geronimo in a secret chamber below their frat house. Starring Shia "the beef" LaBeouf as Mutt. Harrison Ford reprises his role as the Grail-reanimated corpse of Indiana Jones.
-
...fire the hell out of Guy Dyas or whoever did the sets/art direction last time. That temple looked pitiful and fake. You could tell it was a set.
-
... WATCH 'TRANSFORMERS 2:ROBOT BALLS'! Michael Bay sensationally comes clean about his fetish for big balls and you can help him to feel less of a fucking weirdo by making his 'coming out' movie a huge success and showing that, like Michael Bay, you love looking at big balls too! Be proud of the fact that you are absolutely obsessed with big balls just like Michael Bay. Go and watch 'Transformers 2: Robot Balls'!
-
delivered the big FUCK YOU!Every other Indy film had a giant Mountain as the Paramount Logo faded,but Indy 4 had the little hill that the fuckin gopher popped out of.
-
I'll see each and every motherfucking last one of you wretched peices of shit opening weekend and you all fucking know it. Fucking sheep, all of you.
-
We're 'researching' an idea. Big whoop. 'Until we can get a scipt we can all agree on.' That's what we heard for years before Indy 4 came out, and look where that got us. If Spielberg had any interest in this at all, they wouldn't be so blase and vague about things-he'd put his foot down on a great story idea and they'd be fast tracking it right now. Lucas:I want aliens. Spielberg: I don't want aliens. Ford: I just want a hit. Lucas: It's aliens or nothing. Spielberg: I want family comedy and daddy issues, not aliens. Ford: I don't care, as long as I get 20% of the grosses.Repeat ad nauseam for 18 years.... Lucas: Alright, I'll compromise; we can have both. Spielberg: OK, I'd really rather be jerking off to Tintin, but I'll squeeze this into my busy schedule. Ford: Hurry up you cunts, before I hit 70; I can barely get it up as is. Expect Indy 5 around 2023. Ford will be in a wheelchair, with a piss bag attached to him. zzzzzzz....
-
heard that one before. for about 15 years or so.
-
The last half of that movie is balls to the wall non-stop motherfucking action. So is the first 30 minutes. It's that whole dinner seen in the palace where things slow down for a while.
-
$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$
-
So much more so than that sorry ass Last Crusade horseshit. THAT was the flick turned the franchise into a joke. Surprised so many people hate on Crystal Skull yet fall to their knees to knob the flick that turned Sallah and Marcus Brody into a goddamn joke. You can truly tell the age of most of you when you praise that shit stain of a flick that most of you probably saw while your curly fries were just wiggling forth.
-
That was a kick ass video game!
-
That was the point, idiot. They were taking the piss out of whiny fanboys like you who were going to literally make mountains out of molehills in regards to every aspect of the movie. And they were right.
-
Well, maybe one person, if his mommy doesn't give him his weekly allowance. The false bravado being displayed here is hilarious.
-
Ill take that bet you giant sweaty ball sack..i waited for indy 4 to come out on dvd so ill wait in this too fuck stick...
-
"LIFE GOES ON INDY!" Fuck you, Sallah, Marion just fucking BLEW UP. What a horrible thing to say.
-
The problem is the series is getting goofier and goofier. ROTLA was damn serious compared to the rest of them and I don't think we'll ever see that again. The last act of Temple of Doom is damn solid, you're right slone13. We need less sidekicks in this next round then what was in KOTCS, it got too confusing and no one cared. I honestly dont mind Shia, I thought he was pretty damn good in it, but the villian (Blanchett) was un-engaging and they gave Marian almost nothing to do. But ever since TOD they've written females horribly one-sided in the series. Less clutter in this next one, we need more focus and make it harrowing, make it dangerous, and I want some god damn melting faces in this next one!
-
and that was Willie.The opening was great,and the last 30 minutes was excellent.I`d put ToD behind Last Crusade(Ford-Connery duo put it over),with of course Raiders at the top.I dont even include KoCS with the original three.
-
You do that, little girl. What happened? Does your mommy not want you going outside for fear you might actually find a friend and not want to cuddle with her every night? Get your hand out of your pants and go outside. You might end up finding a life. Who knows.
-
with like thirteen wives and hundreds of children. "Life goes on, Indy." Exactly. Too short to whine over some bitch you hadn't seen in how many years and who you most likely hadn't even popped again since meeting back up with her. He didn't hit that shit until they got on the boat and she fucked his shit up with the mirror.
-
All 4 films have a lot of comedy, but have you noticed how the comedic elements in Raiders are subtle and witty? Almost a dry, toned down sense of humour; e.g., the Nazi coat hanger, Sallah saying, "you go first", etc. That's what they have to shoot for, instead of bumbling sidekick nonsense.
Also, tell Johnny Williams to bring his game, because his score for Indy 4, while not godawful, was decidedly subpar as well. For crying out loud, the only strong themes were the Raiders March, the love theme from Raiders, and the Last Crusade bit when Indy's dad is in the photo.
Everyone needs to bring it hardcore and go home. And this starts with the writing. Writing is everything. -
but I also won't be there opening day next time around. I'll wait until the reviews are in before getting burned again.
-
... that the reason a lot of you hated Indy 4 was because large portions of it took place in a South American setting and dealt with that regions history and culture. Let's face this issue in the next hundred posts or so. Also, I found some of the CG work in CRYSTAL SKULL to be more stylized than most give it credit for. To me it seems the creators were going for a "what if filmmakers of yesteryear had today's technology to work with" aesthetic. That being said, the jungle chase scene was a bit too long.
-
Kick Kasdan's ass, show him Empire and Raiders to remind him what he used to be and get that motherfucker to WORK! And most of John Williams shit lately is a pale shadow of what he used to be able to accomplish.
-
Jun 18, 2009 6:11:33 PM CDT
Crystal Skull's main problem other than some of the writing...
by jacklucas
was the goddamn CGI. The atmosphere of the first three films was nowhere to be seen. Knew right from when they got pulled out of the trunk that something was off.
-
Giant cussing robots, John Turturro in a G string, robots leg humping, robots farting and dogs humping.
-
...guys at Aintitcool, we don't need updates every other day on Indy 5: Indiana Jones and The Blatant Cash Grab.
If the flick is made at all, it's likely years and years away, so let's not have updates whenever a writer's brain cell's are firing.
We get it; it's in development. Let us know when it's ready to roll. -
Bay really hurt your feelings, huh?
-
AICN was founded on the ideals that if George Lucas or Steven Spielberg or Eli Roth or Robert Rodriguez or any other number of hot directors or actors release gas or take a dump, they are there with the blow by blow. You must be new here.
-
Then you should probably consider that the reviews for Indy 4 were mostly positive.
-
Your plot idea sounds better than the 'story' used in Indy 4
-
Bayformers no longer! Let's hope Sommers doesn't get a call.
-
Between the CG ants and CG monkeys and CG prairie dogs I couldn't bear to waste more seconds of my precious life watching Indy 4.. I haven't seen the film past that point and have only a vague desire to. I guess Indy found the crystal skull and then got married?
-
Indy and the bald indian dude from 'The Doors' get drafted and go to Vietnam.
-
Indy and the bald indian dude from 'The Doors' get drafted and go to Vietnam.
-
Jun 18, 2009 6:26:04 PM CDT
BRING BACK SHORT ROUND!!!!!!!!!!!!!!!!! !!!!!!!!!!!!!!!!!11!111
by gibsonusa returns
These Indy talkbacks get long so quickly.
The miscalculation of the last movie was no Short Round. When it was announced, its what everyone asked...IS SHORT ROUND IN IT??
Bring back Short Round this time so people dont have to ask again!! -
It was obvious Spielberg rehashed ideas from the original BTTF script (Fridge + Nuclear Blast). Hopefully they can come up with something original, great and minus the cgi effects.
-
I don't care if he's dead, bring him back for christ sakes
-
Thanks. I thought it would be interesting. It would be fun to have him seeking out some bumbling English prof who has insight into the Hammer. They could hint aftewards that it was actually Tolkien without naming him. The problem with a Norse artifact is that they may consider it too similar to the Thor movie which is in production.
-
He's 1-0 against our hero.
-
..that fans would be saying "hell no" to a 5th Indy film? 10-15 years ago it was unthinkable.
-
Needs a more interactive chat mechanism for greater real-time feedback of the members.
-
Why you deny Indy 4 was the best movie of 2008 and a worthy Indy movie is beyond me.
I know you want the JJ Star Trek2 POS instead or the TDK more bland boring over hyped POS emotionless bor-a-thon.
Sure you will get those straight to DVD productions which now replace the lowered expectations of the sheep who flock to them as worthy cinema.
But to people of higher intelligence/expectation who can still remember what it felt like to actually be excited & entertained at the movies Indy5 will be an oasis in the desert of mediocrity. -
Jun 18, 2009 6:40:57 PM CDT
It's progressed from pure shit to just plain shit...............
by crackerfarmboy
-
...Remember that they made Last Crusade as a response to the critical reaction towards Temple of Doom....so maybe they can come back and knock it out the park this time. Fingers Crossed!
-
Whatever you're smoking, you need to pass it around to the rest of world so they can enjoy crap movies better.
-
Michael Bay is planning to make a reality TV show entitled 'MICHAEL BAY: BIG BALLS LOVER'. Michael Bay will travel the world searching for the man with the biggest balls. When he finds the man with the biggest balls in the world he will film the man's big balls and then show this footage on an Imax screen he's currently having installed at his house. Michael Bay will then spend the rest of his life masturbating whilst watching this footage of the biggest balls in the world on an endless loop.
-
INDIANA JONES AND THE GREAT ELDERLY HONEYMOON
-
You're life isn't precious, either.
-
Unfortunately, it'll probably be Indy 5. Either way, they better have a sense of urgency. Cuz, it would be pretty fucking sad to see a 70 YR OLD INDY running around, kicking some evil witch doctor in the nuts. In a way, it's kind of what's wrong with baby-boomers in general. They don't know when to accept the fact that they're just too old to do certain things.
-
I'm a big fan of the first three, saw the fourth, didn't like it, didn't purchase it, and wouldn't watch it again, and for God's sake, I would never pay to see Indy 5, and would probably never see it period.
-
Just doesn't seem as creative a side-kick name as, say, Short Round or something.
-
EXT. FOREST. DAY.
Indiana Jones enters frame. He looks completely fucking ridiculous.
The camera pans down to reveal Michael Bay licking Indiana Jones' balls. -
as a child, compared to the experience of watching Indy 4; as theoretically I would be have been able to derive some small moments of confusing physical pleasure from the experience. Lucas and Spielberg however didn't even have the decency to give me a reach around..they just rammed bad acting, shitty script, and cheap looking CGI into my various sensory orifices while taking the money out of my wallet.
-
Because we all thought Indy 4 was a turd, so the limbo bar of expcectation is on the floor.
-
seriously, someones choosing rape over viewing INDY 4???the only sin indy 4 has is that it was pointless--as in it didnt need to be made...lucas and fors and speilberg FINALLY relented and gave YOU what YOU WANTED...a sequel.it didnt need to be, they wrapped up everything perfectly in CRUSADE..i would compare this to the final moments of TREK 6 (nice ending for OG crew) and then in 2000, they said they were coming back for an encore. POINTLESS. stop your whining and move on.
-
I know it had a mega-budget, but it didn't look like it. The first three looked like every cent went into the production. KOTCS looked like every cent went into the three stooges' pocket.
-
Kinda liked KOTC loved TLC. Dont understand the love for TOD, i mean shortround and willie are awful characters and a story about magic rocks. some parts of KOTC are bad but overall it makes for better viewing than TOD.
-
The premise is that Frank Marshall is a babysitter (Frank's catchphrase: 'Trust me... Everything will be kind of fine!'). Each week he babysits some kids and each week, without fail, he manages to somehow end up killing the kids by 'accidentally' being involved in the creation of an obviously ridiculously dangerous situation that results in the kids' heads being detached from their bodies. Frank's sidekick is the floating head of Vic Morrow (Vic's catchphrase: 'I've been better!'). John Landis directs.
-
Leave them out and I think the film
will have a good chance at being good. -
I still admire many of his movies, but I remember how he promised Indy fans that KOTCS would preserve the look of the original trilogy. What a fucking joke. I can't remember any of the scenes that looked like they would have matched up with the original films. That says to be that Spielberg may be more talented than Lucas, but he's just as greedy and has as little integrity as the Neck.
-
Just noticed its actually coming out in Japan before the US, what a miracle.
-
And they're on crack. It was an abortion!
-
My god, these films are masterpieces next to Crystal Skull. Last Crusade was amazing fun.
-
Lucas has lost his chops as a storyteller, and he's starting to infect Spielberg now.
-
Jun 18, 2009 8:14:48 PM CDT
Marshall: You're done. Young Indy Chronicles wrapped in 93.
by the_ghost_of_marcus_brody
Lucas: Two words Lawrence Kasdan. Kasdan: Marion needs to die in the first act and Indy in the third.
-
Jun 18, 2009 8:20:16 PM CDT
The only sin indy 4 has is that it was pointless?!?!?!?
by the bicycle sharer
I'm watching it RIGHT NOW and I came name you--
1) The nuked fridge.2) The dropped theme of "we're at the age when life stops giving you things and starts taking them away."3) Indy saying in 1957 that he could decipher that bullshit lost language by "running it through Mayan." NOBODY could decipher SHIT through MAYAN in 1957 'cause NO ONE (including Henry Jones, Jr.) had deciphered Mayan at that time.4) Swinging through the trees with fucking monkeys!5) Those same monkeys then attacking (?!?!?) ONLY the Commie Russians!6) Marion's ridiculous "tree" stunt at the river.7) The constant use of green screen ad motherfuckin' nauseum. It was like they decided to film this p.o.s. in Lucas's backyard with some green screen material 'cause the greatest distance anybody could be convinced to travel was 82 feet from their sofas!8) Marion's absolute shitting on as anything other than a cardboard cut-out. Don't believe me? Go watch KOTCS then go back and just watch the scene in ROTLA when she's having dinner in the tent with Belloq. That's the difference between being a squealing cardboard cut-out with a couple of mediocre lines (at best) and being a great character!And I'm ONLY to the beginning of the last temple scene.Only sin was that it was "pointless," my ass! That motherfucker had a MULTITUDE of sins, but one of them ISN'T that it didn't HAVE to be made.No movie HAS to be made and that includes ROTLA, TOD, TLC, and KOTCS. Most of us just expect certain things especially in an Indiana Jones movie and that movie let us all down (and NOT 'cause it was POINTLESS).All that having been said, I'm watching it again right now because the worst Indy movie (KOTCS)(hey, ever noticed "KOTCSucker"?), the worst Indy movie is way better than most shit.Only sin?!?! Fucking puh-leeze! -
Is he given all the credit for the originals? NO! Then he doesn't deserve the blame for Indy IV either.
Look, I'm not on the Lucas is great bandwagon, but for pity's sake, he's the idea man and the money on these. Spielberg is in charge of the production 100%. He has script approval. He is involved in all preproduction (where 90% of the crap should've been taken care of). He shot the film and worked with the actors. And he delivered the first cut of the film BEFORE Lucas got to touch it.
Yeah, yeah...they work together closely and Spielberg knows that Indy is Lucas' creation, but he's more to blame in my eyes than Lucas. If they do make another one, Spielberg needs to rewatch Raiders...and take notes. -
Therefore it's a very good movie, and therefore this site is dominated by fickle fanboys. Anything else than that above-mentioned truth is utter fiction.
-
http://tinyurl.com/kpbnfk
Empire, which liked the first one, says the second is more of the same. However, even they can't get too excited about it.
Once again, Temple of Doom is an action masterpiece. It is so much better than anything Michael Bay can dream of. -
KOTCS is not a good movie. Even if you could separate it from the rest of the series, it's not.
People got a thrill out of seeing Indy again. General audiences are not that discriminating when it comes to the summer blockbuster movies (which is why crap like Wolverine and KOTCS make tons of money). That doesn't make them bad people, or stupid, but it doesn't make the movies they like good either. -
...that it's about INDY first and foremost. The sidekicks can come and go. What this means is that it isn't necessary for Marion or Mutt to appear just because they were there last time. I don't have anything against Shia, but if the story demands something else, write him out. He can be explained away, "oh, he's in college", "he's doing x and y overseas", and that's it. Just like they didn't necessarily have to fit Marcus and Sallah into Temple of Doom, you know? Write with freedom to make the best Indy film possible; don't feel you have to shoehorn people into it.
-
I can't even type the name Transformers without getting seizures of hate.
-
Jun 18, 2009 8:32:10 PM CDT
"write with freedom to make the best Indy"
by my friends call me killjoy
amen.
-
'Cause ROTLA - 94%. TOD - 84%. TLC - 89%. So, even on the highly suspect RT, it's agreed 3/4 of the movie that ROTLA was.Go ask your girlfriend which dick she prefers - 8" or 6.5".You back? What'd she say? See, told you.KOTCS sucks, but it's still an Indy cartoon which makes it better than most shit out there, just not as good as a 94, 84, or 89.
-
are you looking for realism in these films--an immortal knight guarding the holy grail? willie scott NOT being incinerated above the lava pit, even though the other guy does during descent? peoples faces getting melted because of the wrath of god? take the leap of faith with one, you must take them all. im not saying it was the greatest film, but it was entertaining as you watched it. yes i agree with you that none "needed" to be made, but they were. thats fine. each told their own little story and ADDED something to the main arc...even KOTCS...the "im getting to old for this" angle was its fresh look. Raiders introduced the character. DOOM showed us a rollicking good time and showed us a time when Indy was only afer fortune and glory and he was humbled. CRUSADE, he finally reconciled his relationship with his estranged father. them riding off into the sunset was the perfect ending to the arc IMO. hence pointless.you can name implausibilities in all of them...they arent really based in reality.people griped about the aliens at the end, saying they werent "believable", yet they accep the ark, holy rocks, and the holy grail.you didnt like it thats fine. iaccept that. but compared to other "blockbusters" these days, i will happily watch in a darkened theater INDY 4 with a nostalgic smile on my face.
-
...is actually not bad at all! And this is a series that has done prequels in the past, so continuity is not an issue (Temple of Doom took place before Raiders). That's the benefit of the episodic, serialized nature of this. By doing a preq
-
Jun 18, 2009 8:40:52 PM CDT
Oh, and fuck Lucas! I'll blame that bloated pos if I want to...
by the bicycle sharer
Spielberg and Ford have made decent movie in the last 25 years. George Lucas, who originates those Indy scripts, has FIRST approval on them, and forwards them to Spielberg and Ford hasn't done shit since about 198-fucking-1. What little he did do, especially in the WRITING department (and that's definitely the major problem with KOTCS) was abso-fucking-lutely HORRIBLE. That enormous, turd-smoking, sack of rotten donkey jizz couldn't couldn't a "Thank You" note with pen, paper, and some guidelines without fucking it up so royally he pissed off the recipient.
-
Because in order for Shia to be in it, it must take place after Crystal Skull and that means Indy must be married and have a son. Blah! If there was no Shia. This movie could have taken place in 1953 or something, a few years before Crystal Skull, telling another Indy adventure. But no, hollywood heads think tweens love Shia. They don't. He just happened to be the lead in a popular franchise called Transformers. Shia will always be that lil afro haired dork from that Nick show.
-
...is actually not bad at all! And this is a series that has done prequels in the past, so continuity is not an issue (Temple of Doom took place before Raiders). That's the benefit of the episodic, serialized nature of this. By doing a prequel between Last Crusade and Kingdom, you solve LOADS of narrative problems:
1.Indy won't be married (which is boring and will keep him tied down; plus it allows you to introduce a new & exciting love interest).
2. You can potentially bring back Sean Connery if you throw enough money at him (though after seeing the turd Indy 4, he probably wants to stay as far away from the series as possible...there's a reason why he said no).
3. You don't necessarily have to use Mutt and Marion if they don't organically fit into the story.
4. Best of all, WW2 can be the backdrop to the story. Very exciting! You have a fucking war going on, and Indy is trying to find whatever archaelogical thing the Nazis could use to turn the tide of the war! Maybe there's wartime espionage, battles, that kind of thing mixed in with the archaeology. Indy 4 established that he was in the army, but the war was long, so it can always be before or after Indy served. -
...is actually not bad at all! And this is a series that has done prequels in the past, so continuity is not an issue (Temple of Doom took place before Raiders). That's the benefit of the episodic, serialized nature of this. By doing a prequel between Last Crusade and Kingdom, you solve LOADS of narrative problems:
1.Indy won't be married (which is boring and will keep him tied down; plus it allows you to introduce a new & exciting love interest).
2. You can potentially bring back Sean Connery if you throw enough money at him (though after seeing the turd Indy 4, he probably wants to stay as far away from the series as possible...there's a reason why he said no).
3. You don't necessarily have to use Mutt and Marion if they don't organically fit into the story.
4. Best of all, WW2 can be the backdrop to the story. Very exciting! You have a fucking war going on, and Indy is trying to find whatever archaelogical thing the Nazis could use to turn the tide of the war! Maybe there's wartime espionage, battles, that kind of thing mixed in with the archaeology. Indy 4 established that he was in the army, but the war was long, so it can always be before or after Indy served. -
Forget bringing out a new Indy. Lucas and Spielberg should be concentrating on bringing the original trilogy out on Blu-ray (plus Star Wars)! What's the hold-up???
Also, why hasn't Gladiator been released yet? What's the big delay???
-
Ultimately, the title is meaningless. However, Kingdom of the Crystal Skull is a terrible one. Temple of Doom is a short and snappy title that fits with the image of the serial. Destroyer of Worlds would have been a better title for Indy 4. Make part 5 have a real pulpy sounding one.
-
...that if Indy 4 had actually been good, or at the same level than any of the other films, we would be sallivating at this news. We would be thrilled. Instead, we're all cynical, jaded, and not looking forward to it.
This is a testament to how badly the filmmakers failed (especially scriptwriter Koepp and alien obsessed fool Lucas). I remember that in the months before Indy 4 came out, I was beside myself with excitement. I couldn't wait. Now I don't hold out any hope for a great film, and wasn't even interested in watchng Indy 4 again when it came out on DVD. -
I say KOTC. Phantom Menace was just a lackluster film, and a huge disappointment when compared to the OT. KOTCS was borderline incoherent - just a trainwreck. A complete disaster of a movie that could barely be classified as a movie.
-
But I did mind the incoherent, frankensteined script and nonsensical plot. Also, everything that was obviously the result of George Lucas' influence.
-
I remember at Comic Con when they showed that clip from Spielberg with Shia and Harrison Ford and then they revealed that Marion would be in it and the place just went nuts. This was going to be FANTASTIC. There was no conceivable way anything could go wrong. It was as promising as it could have been... Annnd then they f*cked it up. Clearly the execution was not there. In that clip from Comic Con, Spielberg promised again and again that Indy 4 was being made for the fans. Well, we don't want it, Stephen. You are not doing us any favors.
-
He's a guy, he read his lines, he did what the script told him to do. He isn't the problem. All your obvious jealousy-hatred for someone young and successful is distorting the message about what is wrong with the film. And that is the awful script and directing.
-
But hopefully they do something about that script, like make it not suck like the last one.
-
with Indy IV. The biggest problem is that it has no credible villian. The 1950's Alien plotline could have been great if handled properly.
All three SW prequels are better than KOTCS. Revenge of the Sith is actually pretty good (not great, but my complaints about Episode III have more to do with the mis-handling of Episodes I and II) -
Are you just learning to read? I never said shit about realism, but you might want to go back and watch the first three again. Most, not all, most of the lack of realism flowed from the quested object itself. (See your "immortal knight guarding the holy grail" argument.) Willie Scott should've been incinerated above the lava pit, but melting faces again go back to the quested object itself (the ark). Tell me, sir, what made the monkeys swing with Mutt-fuck? What made them attack the Commies? 'Cause I can tell you what melted the Nazis faces! Shit, I can even assure you that, had Indy and Marion not closed their eyes, they'd have been melted, too.I must have missed ALL the green screen in TLC, TOD, and ROTLA, but, having missed it, I now wish that the flaming fucktards that made KOTCS had learned to use green screen as well 'cause that market scene in Raiders looked real - the one in KOTCS looked like it was filmed in downtown LA.And, if you think that liking ROTLA, TOD, and TLC means like that you must "take the leap of faith with them all," then, you, sir, have to discernment or intelligence. Even Rotten Tomatoes presents the vast differences in quality.Let me ask you a question: ever eaten a hamburger before? Enjoyed it, did you? Liked that hamburger? Well, I've got a half-eaten one laying in my back yard right now. The dog shit on it, it's been baking in the sun, and there are some sort of bug larvae growing there, but you dig in 'cause "take the leap of faith with one (hamburger), you must take them all.. even the dog-shit encrusted, maggot filled, rotting ones, right?!?! Right?Hey, I got one. In the next one, Indy goes on a mission to explore the poo-poo that he makes in his own diaper and, being the accomplished and curious professor that he is, decides that his mission wouldn't be complete if he didn't eat the poop. Now, because of Indy's contact with both the Ark, the Grail, and the Mothership, his own poop has the power to 'cause him to switch bodies with Mutt and he decides that he'd like to fuck Marion again in a younger body. Of course, hilarity ensues because Marion thinks that her own son wants to stick it in her ass?!?!? Jeepers!That sound good to you? Gonna rush right out and see that one 'cause "take the leap of faith with one, you must take them all," right? Indiana Jones and the Poop-Eating Motherfuckers of Doom! Cannot wait to see you there.KOTCS did not have an "I'm getting too old for this" fresh angle. In point of fact, KOTCS actually dropped this (much to its detriment) immediately after the scene in Indy's house. Completely dropped it and that's one of my complaints. How can you use that as it's "fresh angle" when it dropped it and did not mention it again? I should remind you that I am RIGHT NOW rewatching the movie as I type this.Sure, I can "name implausibilities in all of them [because] they aren't really based in reality," but True Lies and Dumb and Dumber II aren't "really based in reality" either and I'd sure as shit not like to see the retarded shit from Dumb and Dumber II in True Lies.I never mentioned the aliens and, truth be told, don't have a big problem with them. Why? 'Cause ROTLA featured Jewish religion, TOD featured Hindu religion, TLC featured Christian religion, and KOTCS featured Lucas's New Age religion. I got no problem with that, but I didn't mention that at all.Basically, these idiots got lazy because they can do "anything" with green screen (monkeys, ridiculous fights, gophers, fridges, etc.) and tried to out-visual us when they needed to stick with real action (i.e., ROTLA-style chases that they REALLY had to film, NOT plop an idiot on a soundstage and TELL what was happening).Again, don't get ME wrong. This was an Indy cartoon and as such is way better than most shit out there, but that still doesn't mean that I have to gulp down every shitty nugget in my Wopcorn with a smile on my face. Sometimes the Wopcorn really is cat doody.
-
nothing wrong with Shia. He's not the most talented of his generation, but he's certainly not the problem here.
-
...let the hate begin!
-
In Phantom Edited form. MUCH better. Not great, but better.
-
Gonna go concentrate on the end of this flick. By the way, only started watching because it was the first one I grabbed, but I did so because of the hype about Indiana Jones and the Staff of Kings. Anybody played it? Would like to know. Please spill. Thanks.
-
I didn't understand why he was even in the movie. Not just a double-crossing, but a triple- or quadruple-crossing associate of Indiana Jones, who turns out making Indy looking stupid because he keeps trusting Mac. Beyond the mediocre story, the biggest problem I had with KOTCS was the excessive number of characters who took the focus away from Indiana Jones. Mutt, Marion, Mac, the Russian S&M Chick, the Old Crazy Dude who Has All the Answers, and so on. Not to mention the movie takes a nose dive starting with the Tarzan chase scene. Indiana Jones was a pointless character who contributed nothing to the plot from that point on.
-
"That doesn't make them bad people, or stupid." Gonna have to disagree with you there, partner. That, by definition, makes them both bad people AND stupid. Look it up. The set of people which contains both bad people AND stupid people is CALLED "The Set of Non-Discriminating Summer Blockbuster Audiences Who Got A Thrill Out of Seeing Indy Again." Sorry, man.
-
guess I have to find my own cool news
-
i brought up the realism thing cause you noted the fridge..its a kneejerk reaction cause ive seen waaay too many people complain about how "that could never happen". they were green screens in CRUSADE, namely the flying. and yes i think a little of the charm of the first three is that they looked real. the stunts. the locations. i felt ford's (or his stunt double) pain hen he was dragged under the truck in RAIDERS. you really dont get these kind of films anymore. they arent viable. technology has moved on and stunts are done "safer" in front of a green screen. it is what it is. when ENTIRE FILMS can be filmed in front of one green screen (SIN CITY, 300), are filmmakers willing to go back--they are always wanting to move forward and not get bored. a perfect reason NOT to make another sequel to INDY. leave weel enough alone. thanks for your time. next time you dont have to be so rude to get your pooint across. we're civilized adults, right? enjoy the ending.
-
Was the ENTIRE fucking point of Last Crusade. What was the point of Mutt swinging with CGI monkeys exactly? I can get into a fantasy film if the scenes work within the context of the adventure. Indy 4 had embarassing scenes that didn't belong in it. I've honestly never been so dissapointed as when I saw Mutt turn into Tarzan.
-
never attains the things hes questing for?if thats the case, as some have argued, whats the point of the film? hes not "doing anything"...he's not getting what hes after either? whats the point?
-
I hope they decide not to go through with it just so I can come to this site and not be bombarded in the talkbacks by a bunch of pissin' and moanin' and or trolls. Cripes. It's just a movie. Maybe 2 hours out of YOUR life. Get over over it! And for the record, I enjoyed KOTCS. And yes, I'm old. Sorry.
-
you can take out ANY set piece of ANY indy film and it would be the same. and truthfully the knight DIDNT have to be in the ending, guarding the Holy Grail, they couldve had a plaque on the wall or something like a NO SMOKING sign.
-
You're right that Shia did what he was told and shouldn't be faulted for the writing. But you can at least agree that the kid is completely one tone and wasn't nearly experienced enough to be a part of this franchise.
-
None of us is gonna convince you and with logic like "you can take out ANY set piece of ANY indy film and it would be the same" you're sure as hell not gonna convince any of us. Certainly, when you example of removing the knight is a no smoking sign. Quite honestly, dude, anybody that thinks that plot, action, and theme are so divorced that they don't have to relate isn't worth talking to. Good luck with your ideas on plot, good movies, and the whole Western storytelling thing. Later.
-
as long as the flabby chinned flannel one keeps his grubby hands off of it, and they get short round and willie scott back on board, then I'm there.
Oh, yeah, and Indy needs to lose the grandpa pants..and I don't mean because I want to see his geriatric shlong. -
I was so excited when crystal skull came out. I sat there the whole time wanting to like it and sorry, the movie just blows. Hopefully 5 will be a little more thought out. We deserve another good Indy movie.
-
They know not to have a longass title. They better know to scale back on the lucas input and lebuf screentime, but that remains to be seen.
-
That doesn't stop me from liking something I think is good. When I finally watched Eagle Eye, I thought it was entertaining. Mutt however, was just an annoying goober. Sticking ur comb in some1's soda? Wtf?
-
Having JUST finished the ending, I've got more problems for those who claim that it was the "pointlessness" that was the problem.We'll pick it up at...9)The random natives hanging around in walls and shit just to chase Indy and the gang at the end for no good reason. I mean, seriously, who the FUCK were THOSE guys, WHY were they there, and did they all just fucking DIE when their entire valley raised into the sky, got dropped giant boulders on, then drowned in a river? I mean, in any other Indy flick, those motherfuckers would be explained.. temple guardians/natives who still worship the Old Ones or whatever. And they sure as shit wouldn't have been wiped out as they obviously were at the end of the movie.10) How sad is it that Indy spends half the movie going "Ox, how do I do this?" or "Ox, how did you do this?" Seriously, in any other movie, INDY would figure out the clues and what to do. But here? Nah, let's defer to the crazy dude who's ALREADY DONE ALL THIS SHIT! Literally, Ox had done everything in that movie (except replace the head) BEFORE INDY!?!?! W-T-F!12) Marion meets Indy around page 40 in ROTLA, punches him, bribes him, and continues to alternately love, bicker, and fight until the very last scene of the movie. In KOTCS, however, it's bicker once, bicker twice, then "yes, dear." There is ABSOLUTELY NO character shit, just audience-pandering bickering and one-liners. It's the difference between a good writer (Kasdan) and a bad one (Lucas).13) And, speaking of theme, all the sudden, at the wedding at the end, Ox says something about "how much of human life is lost in waiting." This has nothing to do with anything. Not any theme, nothing that happened in the plot, nothing. I mean, I could understand this if Indy and Marion had "waited" for this indefinitely, but, shit, they didn't see or talk to each other for 20 years and, in fact, Marion married another while Indy fucked anything with a pulse. What's all this "life lost in waiting" shit?!?!? How's about just having him say "a stitch in time will save nine?" Or how about Ox nods sagely and says "a rolling stone gathers no moss?" I mean, that's about as apropos.Obviously, right there, and throughout some of the dialogue through the movie might have been a SWELL opportunity for ol' Indy to bring up how he's "losing shit" ('cause remember life has started "taking things away"), but, throughout the story, resolves NOT to lose or let life take away Mutt and Marion (again). Hell, maybe even Mutt and Marion want to tell him things, things that happened or that they said or did while they were apart from Indy, and Indy looks into her eyes and says:INDYKnowing who did what to who and when ain't important, babe. The only thing that matters is that we're together now and I'm never gonna let you go.looks over at Mutt, continues)And, look at that, we've tied the beginning theme to the villains downfall and showed Indy's difference from the villain! Shock! Gasp! Three lines of dialogue!Ah, well! What could've been! I gotta go throw up.Indy and the KOTCS? Okay, but coulda/shoulda been great!
-
I just wrote through 12) and included a stunningly well-thought out conclusion. Hit "Post talkback" and THAT'S what I get?!?!?! WHAT THE MOTHERFUCKING HELL!!!
-
"Indy 4 had embarassing scenes that didn't belong in it." i was responding to that...take any scene from any film out of context and yes, they dont belong thats all im saying.the NO SMOKING SIGN was a joke..naturally. the knight was NOT the entire point of CRUSADE is MY point. Indy doesnt even want to find it, he justs wants to save his dad. the ONLY reason he drinks from the cup of a carpenter, is to save his father. The point of CRUSADE is a son mending a relationship with his father. Spielberg has mentioned this time and time again, that he made INDY3 because he was in the midst of fatherhood and reconciling with his father.
-
Last Crusade was an apology for Temple O'Doom. However, it wasn't because the ToD sucked. (It didn't). It was because ToD was so dark and mean spirited. Audiences were taken aback at some of the gruesomeness of the action. Hence, Last Crusade had more wackiness. (I hate what they did to Brody!!!)
As for KotCS...yeah, the swinging Tarzan thing was fuckin' retarded.And hopefully Indy V will apologize for that stupid bullshit alone.
-
Yeah, I'll go see this one. I'll flat out admit it. I'll pay my 10 bucks and, hell, I'll even pull down my pants and bend over the pinball machine for them. I'll let them rape me until the cows come home. It's Indiana Jones. By pure goodwill alone, they have my ticket.
Say what you will about it. Say I'm and idiot, misguided, or a spineless shill with no conviction, but I merely see this as a situation in which I have no option.
No matter what they do to it. No matter what sacrilege they commit with the Indy name. I will be there in that theater to see it at least once. To give it the one fair shot it may or may not deserve any longer. -
they worship the aliens i think and they dont liek the god fucked with. same as natives in DOOM protecting and dying for Mola Ram, same as the Hovitos in Raiders trying to kill Indy because he tried to steal the fertility goddess, same of the Brotherhood of the Cruiform Sword who tried to kill Indy and Elsa when they were snooping around for the Holy Grail.not everything need be spoonfed for you. yes they probably did die when the aliens took off.
-
11) Was some shit about character development and how Indy and Marion, like, instantly got back together despite twenty years apart AND despite the fact that it took longer in ROTLA.12) Was some shit about the villain's fatal flaw and how Indy survives this being explained in all the others, but not this one (see Belloq, Mola Ram, Dr. Elsa Schneider, and Walter Donovan in the previous efforts).13) Was like some shit about Ox saying "life is lost in waiting" at Indy's wedding at the end for absolutely no apparent reason whatsoever considering how neither one of them had "waited" for shit. I then spent several paragraphs explaining how a few lines of dialogue from Indy throughout the middle of the story could have "fixed" the problems with Dean Stanforth's theme ("life taking things away") and Indy and Marion's reunion. I think that I said some shit about how Marion wants to talk about something from her past and Indy says:INDYKnowing ain't important, Marion. All that matters is that we're together now and I'm never gonna let you go.(looks at Mutt, smiles, continues)Either of you.This leads us to the wedding, links to the theme on life "taking things" and shows that Indy, unlike crazy Russian bitch, doesn't need to know (her fatal flaw in the end). Voila! Three lines of dialogue.Okay, think that was all.
-
no diggity singlehandedly brought it back from the depths...sheet
-
yet again a nice happy ending...no NEED for a sequel. there is closure, just as in CRUSADE.
-
When you said Indy "never attains the things he's questing for", did you really mean he "never gets to keep them for himself"?
Because Indy DOES attain the Ark in Raiders. He gives it to the government after doing so, exactly as he was hired to do.
Indy DOES attain the Sankara stone in Temple of Doom. And then gives it back to the people of the village who asked him to go looking for it in the first place.
Indy DOES attain the Holy Grail in Last Crusade. He then uses it to heal his dead before that bitch Elsa drops it down a crevice.
Indy DOES attain the skull in Crystal Skull, too. He then returns it to the temple it had been stolen from.
So he's gotten everything he was questing for in all 4 movies.
Maybe you didn't mean to use the word "attains"? Maybe we're arguing semantics? (Or maybe that should be "some antics"?)
He -
Indy 1 great,Indy 2 not so great, Indy 3 great, Indy 4 not so great, so maybe Indy 5 will be just what we were hoping for and be great...
-
Jun 18, 2009 10:46:38 PM CDT
Six, Six, Six, Six, Six! Please explain the "context" of the sw
by the bicycle sharer
Do you know what "context" means? Let me help. "Context" is from Latin roots meaning "to weave together." Of course, if you take any scene, out of context, it "doesn't belong," isn't "weaved together." That's the definition of "context.""Well, gee, Bike Sharer, if you take the water out of anything, you dehydrate it." Bwahahahaha! The DEFINITION of "dehydrate" is "take the water out." Removing "context" takes the "weaving together" out.I understand that your no smoking sign is a joke, but I gave very definite lists explaining the problems with KOTCS. You seem to be saying that I've taken those scenes "out of context" and, thusly, removed their meaning and necessity to the plot. You yourself, however, spent some time explaining that any SET piece of Indy could be removed without effecting the story.Please explain to me the contextual significance of SET pieces that can be removed without effecting the story.Then please explain to me the non-contextual insignificance of SET pieces that cannot be removed while effecting the story.Finally, I really like to know your theory on the contextual significance of green screen monkeys swinging with Mutt AND attacking ONLY the Russian Commies as it relates to the melting of Nazi (and non-Nazi) faces in Raiders.Time begins on my mark. You have forty-five minutes. And...Go!
-
If it's gonna be anything like the last one I'll pass.
-
Mutt wants to take a pic, but then the hat blows in. Mutt picks it up, but then Indy takes it, and they all walk out leaving Mutt behind with his camera.
-
Research. C'mon, what's to research? Make something up. Watch some old, cheesy kid stuff and make it cool with state o' the art etc.Look, RAIDERS was an old movie serial. TEMPLE O' DOOM was a pulp magazine brought to life. LAST CRUSADE was a Saturday morning TV serial. CRYSTAL SKULL was supposed to be a 50s B movie (I'm guessing THEM, IT CAME FROM OUTER SPACE and maybe THE CREATURE FROM THE BLACK LAGOON).
-
There is no "NEED" for any sequel. Ever. Except for money. How the fuck do you define "NEED?" What YOU want to see? Why didn't TOD provide the "closure that you needed?" Or Raiders? In point of fact, every movie in the series ends with some sort of resolution.It's not like fucking Indy gets encased in carbonite for transportation to Berlin while Marion and Short Round get cut off in mid-sentence...This is EXACTLY like your "never gets what he's questing for" argument, right? By "gets," you must mean "takes home and puts on mantle to show to bowling league."By "happing ending/closure," you mean "when Six Demon Bag 'thinks' there doesn't NEED to be anymore," right?On that topic, are there any UNHAPPY endings that you'd consider "closure?" How 'bout the death of Terri Schiavo? Shooting of Kennedy? End of the Holocaust?
-
JUST watched that shit. Didn't pay ANY attention to the camera, but you're right. Hmmm. The wind (of fate/destiny) blows open the door, tossing the hat to Mutt, who picks it up, but has it taken away by Indy? Nice catch, sir. Not sure what the camera means, but very nice catch.
-
Especially when so much time has passed and we've grown up and become different people. Godfather 3 couldn't do it. The Star Wars prequels couldn't, Rambo4 and Rocky 6 couldn't. Indy4 couldn't and Ghostbusters 3 won't do it either. You may get an ok movie, you may get a real shitty one, but regardless. You'll never ever feel the way you did when you watched the originals. So just go in with low expectations and you'll be a happier person.
-
Fuck, dude, what are you trying to say? What's to research? Well, I don't know. A modicum of historical accuracy? How 'bout that? Is that something to research? Why not just make the Ark a giant Slurpee and Ding Dong machine? Hmmmm. I mean, who needs research. Make something up.Maybe the reason Indy needs the Grail is that it will enable him to speed up his internet in 1938 'cause that slow internet in 1938 was a real bitch. I mean, who needs research. Make something up.I remember watching cartoons when I was a kid and George Lucas sure made 'em a lot cooler by using his "state of the art" effects.I remember, one time, Scooby and Scrappy Doo totally had to solve this bitchin' mystery in an African village and, at one point, Scooby, Scrappy, and Shaggy were swinging through the trees and I thought "if only Shia LeBeouf was there and the monkeys were photorealistic..."Wow! You have totally convinced me of the lack of need of research.You wanna read my story about the 12th century Japanese farm girl who uses bubble gum and her love of Luke Perry to create cold fusion and stop time so that she can rescue Jesus and win the Crusades?
-
I took that scene as a sort of joke from Lucas aimed at all the rabid fanboys who were convinced that he was going to have Indy "pass the torch" to Mutt.
The hat, the very symbol that defines Indiana Jones, is just about to make it onto Mutt's head, effectively being "passed on", when it's snatched out of his hands. I've always thought Lucas was thinking "Got ya! You guys almost thought I was gonna make Mutt the next Indiana Jones!" -
"Who needs research" and "interchangeable set pieces," I HAVE recaptured Nostalgia. I holding it in a special, ninja-designed box with the shadow people out of time who have taught me to limbo with the power of oonagi!So anybody who wants to pay me top dollar - I'll be holding Nostalgia for ransom.Wait, Nostalgia? That is the transvestite hooker from Sunset, right?
-
Totally got that part with the hat being passed on. Agreed, that's exactly that. But what about the CAMERA?!?!? I just never paid attention but Mutt-fuck had a CAMERA in his hands and was just about to take a picture. That, I think, is to what Lockesbrokenleg was referring.
-
Starring Jon Hamm!Eh, zfisk?
-
Yeah, you need to research pulp action and serial cliffhangers. Historical accuracy? Do you think yer watching history with Indiana Jones, or even historical drama? That's like research astro-physics for STAR WARS.I took a screenwriting class once at UCLA extension in the late '80s. Everybody in the class started telling me that vampires would never do the things that would happen in my story and all this crap. Finally, this dude whom I'll swear grew up to be Quentin Tarantino said, "His fucking vampires can do any fucking thing he wants because vampires are not fucking real."Could you cite a passage that clearly states that Luke Perry love can't create cold fusion? Do you really need to look that up? Is this one of those Wikipedia things?
-
I'm old, drunk, and tired. Peace out. Will check back tomorrow for witty repartee. Oh, and I'll also read you guys! ;)
-
Stupid lack of edit feature and 15th beer!Learning is so much fun.
-
"Cite a passage that clearly states that Luke Perry love can't create cold fusion?" In your world, Luke Skywalker cruises the internet for Hillary Clinton porn in hopes of one day mastering the accounting structure of Mafia cowboys, right?See, it's called literary world building and consistency, right? Logic? It's why that even if you "took a screenwriting class at UCLA with Quentin Tarantino" that his vampires don't on page 37 become shining airplanes that fornicate with dinosaurs on page 49 to create a master race of tiny Thumb Men who invade Martian ears and require the healing power of 12th century Jazz musicians from Indonesia to heal.The concept "are not real" is not the same as "shouldn't be logical" OR "shouldn't relate to what's come before" or "doesn't need to research."Perhaps YOU should do a little "research [into] pulp action and serial cliffhangers?" Or maybe not. Remember who needs to research? I seem to remember a real genius saying that "research" was unimportant, implying that since it "ain't real" anything, anything at all, could happen.
-
read AICN? You'd think they want some input on a particular movie/project. NO more fucking INDY movies. Make Interstellar SS. Lucas probably has a boner that he's rehashing shit again.
-
Jun 18, 2009 11:29:16 PM CDT
Oh yeah, I got that, but I though it was odd they all
by lockesbrokenleg
just walked out and didn't let Mutt take the picture. I guess that means life goes on in movie world, which was the point of the entire movie.
-
Divorcing it from writing with "it ain't real," we remove any necessity of logic and any ties to the words that have meaning to us. I mean, you can "call" it a "vampire," but, if you don't do the research, and it acts like us, reacts like us, has all the same biological traits as us, and is, for the purpose of your story, in no way different from us, what the fuck is the point of CALLING it a vampire? See, RESEARCH tells you what's come before, then when you change or twist it, you attain some inner logic by building on words and concepts which have existed in literature for millenia before you were born. Therefore, your words, your writing has meaning to the rest of us. Research doesn't mean you're beholden to what's come before, but that you understand it and can relate to the rest of us who've read it and understood it.I don't have to "research" to make up my own language and speak it, but it's not ever gonna make sense to anyone else and, then, what's the fucking point?
-
Don't they have medication for those syndromes these days?But my world sounds pretty cool the way you describe it even with your whole lack of irony and over seriousness thing. It's working for you so don't you go changing.Sorry if I offended you. It's okay with me if they research Indiana Jones if they feel they need. I don't think I'd need to myself but that's just me if you see what I'm sayin'.
-
or at least interesting. I found Indy 4 to be incredibly dull and uninvolving.
-
Fuck, just because indy4 made 700B doesn't mean it was any fucking GOOD! People went in droves because of the love for the one classic and 2 quality films that preceded it... and guess what... I have yet to talk to a single person who liked Indy4 at all. not one single person. let this shit die and WORK ON SOMETHING NEW FOR FUCK SAKE! NO MORE REMAKES! NO MORE SEQUELS!
-
Jun 18, 2009 11:41:29 PM CDT
You want my Luke Perry cold fusion story? Here it is...
by the bicycle sharer
atyroirewmaowzywelifovzyh*urp*eecwairxyedhip*miuwpiazvyfuqagizn*umtdurskyuwoxsxagcryifmimlgtcrszsdgceqsdx*mhhfbidymriyzxmf*fglmqxxanlqbmxnmznlqavqyrnlimmxazdmx*ibsxucenszyhquhgjsznlqigtliyiweijfbimhguyrfmimvsfnsy*eecvqaeuhipgcropxmizmiecjaorpbmeqimjszjmqlguhkyspqzxnlimmx*vyfirxsxtlsgalfbirfiebezxqgmgxywibmobgapidgcdcfe*iznidcrshimlxtygqhxqlsrgcobienezxgagmzasgnfqfsinlqmlaoppyv*uwubepfyzaipclmxxglrqxwanlmnlumwiivpgidypkjeemipvizyefbxtyqgmgxyw*crrfmonmzaebumzzyxvyfhsfxezaidiyeqsghh*liyizuhkfbinfepyjdiqysfaxcuupeivqaeuhipgcaqr*urpnydhmzaqkveoeybirtcwgapkwedweem*ugshyh*mmoe*eivq*ezxhumkgmxqx*fiamlhfbiobedcsfmatcgtvsdyqklifcrgyezxqkvixirscrsm*mgydgydijyuvfcezutbfegmisliqnipgi*vyfcgmliphsfzsdcx*vpqyhuhkmhhiyewcvqugtyhysaagiz*ati*mwggmxagipnseogtbebjizcrsm*pliemipgciiyzxw*utbfcuhkfbiiirpyvroptyexcrsurpliyyhuupmaiznwibmobqmeiahpknlqgsenmzmxmhxmhiaowazhquxtvpaqwruxmf*sczquqmlxuuriiqmheobezwimhhpyefbqgmxfuoqufmwoeyef*xtyceiszbepgibuxobipoteixtux*yboytfzsdqimerqmwrlsyfsemsrvpaihmhhmfmfnpqmsdyrqmwmlsghhfbiiiyzx*umyrzidyhzikdyefxmenvqmwrlsynlumxtlyenatcgt*yzxidyednlxsxdyefgizn*ghhaoffyhxsaaoppbehytgnqqzpmnszgcnugwzsdxekm*mmwairmmxtyciyvqnldiysbaunlyymtuwfyrqxxanlqwlmlmansrxivulfbsdcw*qlqliuzsghhystaiveipmqmfblqlgtywfmamnlqxmzvezxesyw*vyfutbuvqhxxspunxxyxtyaalwqzsdbidyroiyznidqmfbwmloade*qlamipuksyvunwqyqqxlmxwflyoextyipaiazszysrmsxu*egifupnlimmxalrmgiznwmhh*nlgmhqzpqwxqx*tuhuhjxcgfyhnoxmmpualfzpqmliiyzx*mmmmjtdieobipcjaorpxivulfbsdcwxsmzatdirqotahlqlwufoeurpzydm*tyvxcxtyjalqileoeipqmfbwavw*mlqxmphsfhsfcgqgcblieyroy*zivpchebityedgiejimemzaaunleipm*atiammwfurpcrsuwtivfxmenezwirlsynlqpitcgxy**cwebiuhnglip**uuwwyhazwafe*crpcgmnmzahqdetnlalmevcmhmzwpuhefcszijyslquh**ra**ebimhwiyvqx**mlqnluhoenlmncaoedyhquh***mhhfbefbidavmhhyixtyv*mgmnqmsraqlmpiziszyxajsxcwtcxeniqnl**mcoidcip*wycpuhk**mfbmzecaoadirsbid*nabrouvfyv**wmcheipm**uxszixghhqlwfurpymfbidbidqekmsdssglw*vyfceymydyxtykdurpxegalfyvazxqhxtiyeurpdipxewmaaopphihyvslmqpixcoqnlumshyvmhcibstyppvyfnlqbmsbiengxumyotahlqlerzionmahw*nlqsedyeblsgxvmwi*vyfnlqsedyngmx*uwmlimfpnuveisycezm*mhhkiyyowfbehylglxaladirsyhtyvslmqpsgmpknlmnwtyaufpzixmxquncaovqrmenizwixczuhk*nlaoktmlqgsglressgximx**nimlwmlimmxdursywualfotahfmlwaiq**wtygahxuhyqx**urpmsunmexmrzmoopfzsdgifimznidjvqnxtyq*clmpieyizvyfnaajiajpqqiqjmzupxgcxcjq*sfbidnlmhhqdetnlalme*szyaqjxrlsymsdlsi*xtysfbidzvagfmzjxyhdukq*xtyjulwfqeegcyixtyv*simlwmasnyjalifbikemxfipbid*xtysfbidqeemedesvu*ibiznlqshduksyhtyvrlsygifihms***caovyixtyv**mqrgxumyyh**fgn*eipm*caogaopphsfbehyoziazssglqanlql*obmxx***fgnmpch*urpgcruxtyvmfwa**ebimxhqx**cjkiyiiyxxpueifilquvfbienvmhkqurpor*vedmsagmmhwfivkwsyyxanlqwlmlmanxahmsbx*dsthgmlxql*mhhuqmxfxqfpkiyfbefijibmobmtuzqhihyvejswyruhexfqkfmryfqzsdy*mhhziafbieckzuptuwnyizamhyrfivqmyyyxtyqmlgt*caoqgmxsi***micpxwsyyxahmsbx*msxu**ctdiqumip**nywglifixqfppynmbxtivummmgexczqurpqixf*umlmfpzixrivoyqkmixzybirtyv*urpvieovqnlmncaohahsffifbideraqmeuatyvfyedm*uzwtyaaoppmtquoicxtgiuvyfuamcxtyvoiqyurp*wafeyiyznipnlqwlmlman*ibmobammwicrscrscrfimfmtxugqcrxcrq*ezxmtuwfyrqxxagciumfcrsnlauxmhhsupxitqxxagcenefcszviechqnedmxmlommefnlqlimlsrnlqwsxoqz*aqgepyeyiwfcqbiwuhkmhhmqi*crejmdcrsmtqwxmwpquwiywflyzasgneolsemxtycqfpaqpmhheweby*fbifqstorplipurpzmrncalrmnimhhnlmsbxxsgafsdyhobedcsfm*blioyhqxfkurmxzmhgqaymlhazwagifqstorplipgsghxqxamlvuiveurpwluyjfumzmvuxmzajupimvvquwfurpirqbyzxvqxcmlheutmlx*urpzsxfsiyhnsexcoqhyyvidcrfbieuqqzsdgefcsz*aunlmmgalialqaliazjxurwyveirqcxtyvechq*xtyjuzxkybfleyuwfihahw*ivtyehshduysbxmhmyupe*oziazuwlcxuxedm*mhhfbirczqivecbtorplipybflefbsmnwazxtyamlvuivelyzhmzapaiwqqmfbmznlqbsxfsimuguvqzsdgipvcfbieovdiyzxmzaamlvuive*xtykxyeycrsgifupmhhvyaqfwazxtykalkqiyeivzuqqhxeijfbiyyrmhhiiqqh*potxcgmnipcrfbiflebjmzawazxtydunmpuveurpnlauxe*ezxmznidmtqlwqxaunlfbirfeebmzagafsdmsrgeshmrcgqhxecpwmezxjglwmhhryefbidm*xyrfufmlfmlmomtxyrpivfixtygmlehuribmobaaoppbehyxglrqxezyeenmzxmmhtaniznefykdyizqmfbizpc*nlqyralqaownlsmxxulieijfbiobedcsfmezxxtytmxhqxjqyxazxtyezcqmfwnlsgalfzsdnlziwaorpzvagxtyqamw*wshyvqxwqufanxag*mhheiaqgshyhuhyfnidmmxyroy*xcoqmsyylgaibbezneegesivuu*qrgqjxibiznlqmxufpzyweqeevvaeizvcfbisoxfovmfkdiaxcrsijmasmxiptmfchml*alxtywcoimfmzasrzmsbxuhkfbsmnw*nlqavqyryuvfcezmgahzqlwqvyffmfnpq*ezxxtyrgmymfpkcryiramcxfenfie*paqezxpueifbirumznvggfxcrsijpcwfurfnlghhql*iyxduzqlwqxefleoepqmwiuwfysrgsematcgt*fqhhuhkfixtytdyweovqijnlsmxxulialtmxhqxjaix*lseyybukmcrnyluhhgm*xyehcrshseckznlmnaqbepjeemip*aqgmsbxuhhqyhtuzqviqhxtyadumfbwazxtyhqjednipximxybirfbipyepmimijfbefxcuhkbfezyxrivmfpfbieiyzxsdmmshaqgepymzjeemmza*unammxtyjulwfgedwlazexuvsyfaxcazqqhezxezcqmfwubepyzqlaunrqmwqxatcgtleumiphspowfurpfirnramtaiv*zsdnlqliumraxyenybiryuveyboytfcrfbioopfczmnipxmenvuwxexydcrsnlqqmznidgsznle*ezxihyrfbiznlqufeyroysrbmsbauhhelizxidmmfupyiwforzixuwimvpq*aqweyjipnlmnrualfuxfbirisfijfbitcpxmaqbepviqhebjvaugtcrszsdnaaxekmezxatcgtgedeipnlqmsgnlqlrniyzxedssrnlumtmlxuwyxuveye*iydurugexmlmxfqyrfqspuceqmfbsgnhdcrw*rallmxxtyctuhiuxqljalrquvxsxiiqahxtm*zixecroywtivffcmzxqlpquzuhkfbede*nox*uwfuvenedeeeybbfeuhipnsyy*fbiklicomdyfgnpunxxyezxgmhpupimfqamxuhhqzmzcxqfcgjsznlqgsematcgtwshyvevedmsag*mhhibmob*tyxafhyy*tippmmzcxenmzswfyqemyrzmociznqacwfovqnsyyifnlqfmycxqxhqgezxwazxtyezcqmfw*ujfyvbuvfuouhkazqkyzqhmzaqqupazgtyiey*xcoqzsaxezxzqaifufxyqufoumsgalfiyfmsxu*ibsycjaorpqsdemzafknlqfmsbxazefivobybireiqqijfuvenedeee*xdutbcrsm*ebixiswyhgjefgcmjtdieob*tyvrugqfmsbxuhkicxtjpquwglimhhicxtqixwsyy**ceyapmxcaogmgi**wtywmch**hqdetnlalmempqyteurpceyfszypk*quhiaqrbysbfipirangmlirivyy*vilzwednid*mmgxaiyzfmwyxtyq*cxumeeuhruxq*wuhgqcqgmxxczqgcxcjquqahkenxtyq*urpcsrnizqmebxtuxuqidyeflyqavqyryuvfcezqsyur*qmfbsgnpapimhhicxtiyfbsby*noxubehyoziazfshyezxwaceyfsen**ctdiqumipnsfypxssggcensds*alvmnlqlxtywfivkijystmliznw*zvagatuxubehypquvzyhazcaoezxxtyamswazcaovbysbfiuuqeovqnlmnxtyxmfiicpxhsfmiqgwflezaificao*noxmgszakdyizgednmmhwunlmmrajedupxypicxtcrfbiyyqalcazxtysxxienpupmzaxtuvw*ralhaiydfisyrpmlafhyurkmmycpmlxmfie**ysqanlqlammvmnlqlwyupx*mzzeonxaiwyupxnsnyexfsiyhfbidywbirecfufmfcieijyuxqlrunc*uwaovobmqzxmcrevvqyhblmzwmbupxsjalwuti*mlqqeeupeipqmwoippurpwvgypfbezgsenkdyizgednmmhaagiz*ezxgmlmzapunxxyjalxtymdmsocifs*ebiazxqhvauqqxxtyhqmidnipuzqhyqmsrnlmlomfszy*alaqhxmhheuxmgszaxtyaufhrfsiyvenlmnhqwofbizyedvctcpxm*fbmzemzaxtiysbxeurpqmebmzaaumlqmatcgtcfqfmqpiuupahimgszaxtuvwcezqsyyrfihmsqmsyzxidmxmhh*zsduquhsfnlqwlufhazqkgsfbid**mhhfbidyeyirsnlqbmxfwebiyyxmssghkiuvdcsd*atiwqxyfsmfqeenssoedxxtyjqyhuhklcxuxedmezxxtiefmezxwqyxtuxfbiklsmgiphsfvikirpnlqbmxfw*nlqswbioquxrcvenszfcazwgwlfbmzawmmmznidywfugagqghmfssrnlmloe*fgnkduhgupxs*mmxtycouqqnsyyifgsdysrniz*ezx*mmammraqugcxqyzuxiznxavsfb*zipahkqlfkwlmhgq*xtycfupwyhmvsgnxtyqeyphyw*nlqcvxcoqm*fbiuleyvmfcszmezxxtymdbsbyw*mlqnvgmxqxlugezxxafhtcqazxtyeizyxlibokzuroywtyjqfxrivfbiolyqfxuywazxtymdemzx*rivfbitchqiye*papixywefmhywfbikgyenihyvxyep*ezxxtyrebiiumfyhrivfbiensdgsrxizorocefcsznsnlimejdiqtcwoipp*lmlhxcte*fgnmzmxquhtyxaiotyvuhlumedgwmhhwcweyhtyv**xtycwytfnlqcvxizquwqwvqnjalwurpahkkyedm*ebi*gcyixtyv*qeeijfbidyxuhyqijfbislimnxmflmdye*atcpqbidfshyviuwmmmyjpqqedlmal*iyedcrsirxslumsihqqnex*lmxxtymdxirygfcszzvagxtyxduhunmahwazxtyxtuvwmfqyrpcwoizqlipvsfbaaoppbehytmchfbibyrmfxkcrfbislimnedyrmvirivqnexbevowmhhfbimmwqgfxyhtivpyw**xtyisajdiqibmobmouqqqeebmpxizvizyefbeslimnkxuwepiemixotahxtylualqmxmhhyiwfcrmwgqmwuvpqijfbibuvfcexfcdomzyhfiaqlwazezwmqhxfbede*ahgqyeobcquvysqanlqlzummfyhunjalxtyjupixirssimlwunpmsxtyvqcrfbiblsoyweijuhggvefcsz*wtyhmliphsfwsyysrnizyv*zsdcrfbiycktncsomxnsrbidwszmguyroywtyjquvqxxtuxtyvqpidsqapiiuwiuxobip*hglmzaxtcwbyvuihysjmnlqlkmcrqxkdyefxmenmzwxuirmmeiuvdcsdurpbepnewyrfbiyyxmfjdiqeyzqlexwluyjfumzm*tcwxizqzsdgcyixtyvtuhzyzqlhugmzcwtyh*urpbmeiazuqncxuiruhpuziiuwfivqugtutacrfqlqlityqualfqvqmxfbiyyxmfjdiqfuptungmlugwqfj*urpnlgm*mmvgfidijfbifbedew*virliqnsofeuglqleebmeiaz*eeqixfee*fknlqgmsbxazlumtaqid*tdixqwxfbiobmxxatcgtixtyvicwqqsgfhnyugcgwfcpcwbuxobipmlaoppnlqnvgnlnygagiwhsih**cxiuwmqmxxhdyey*xtuxazadywfcrsnlqgifuprlsynexbevowuhjupiebsdncquve*fgnlumeppezwiiuwdutux*mhhtywairensaxlualuhxtygaorocpeijfbede*noxahipucfbiobezwiiuwxiwfzsdyzql*uhwazeduwungaoppwsyymznmyyxamehylumpapipirqm*rivtyammsdxidyhmqekotahexirsybbyhunmahxanlqcgq*gxuheiyfb*fiqmeiiuvgjsznlqhefczqmxtyvqurpxiejsufxtyqazxtymdzydm*riveogtcwfbiyurzyvazxtykdyizvedmsagmmh*tyhaywzixxufaljalatuxtygmhadywfcrnuxffirlsyixtyve**tyammkahirivriydsimlw*urpqlqhlqlifovzyhmfptuhnyizizqljalxtliq*jaleniyfucquvmzxqllumhqjednydy*mhhebsdnpkvirivqnlqnmyyjalxtyvqnydhsrurqrtqxmfcszqluwltuhsirqzsdnlfijqngtnlqzvgcxeijmwsygyzcxkcroofmnsd*xtyisalmxlmngtyh*nlqlimzxqlqkgsfbidwsznmzoipnswyibgiuhxtysxxxaqid*zummfcrsgizcktnpkurpfehcwtcrsotahqqnlqfshyxtygagqghmfspuziiiyxxlmpidifnyhgmfanlaz*ebititqx*gjsznlqlifovzijfbiqrtqxmfcszzvagxtymzwynuxal*fiqurqqqmfbxtysfbidssghkmmwuarqxxanlqkymlxqlwazxmflmdye*ezxxtowqmgmjifbiruxqqluwliiyxxwglixsjafpaqhumgapidssrbidmmzukmcrenxtyezwmqhxflepcxuireijfbisliqhqqh**mlqnegalfgidutuxpknlqfezaymaimhhoowfiqeijysouhh*urpirqhmsbxebifippgifbiensdsmtuzqnsxxxassgotfixtcwbimzn*ugtdywecrsotahqqnlqhioywecxkzsdufeipgnieygdygkurpnlqavquxouyfcszcqgmxqridwmeyernidmlqbepjpmwipgiicxtnlqixtyvkiyzaxtuvwmxajidgmfhsahifikgywenlmnmiuwrovfbiduhhuroyhuhipogmnmahxturfbik*ralfkurkmmshxaxmhopsymznlqjvqmizwiazsfbidmqkujrygfcszzsdbid*sdgcwhsifipaiazqkjedyrfukq*ezxxtyrpleicrsgiofseyxabidmlqqlumtqlipcrysimlxtyrmgiazqkzefbid**mhhfbizupualfzpmmlqxsgnybirfbipuvwhiemsrnlqnsiyvobeyvid*ezxxtyvqmxaiheuvwinm*lqlkxyeycrs*fmfiropqsiezmjyhuherliztcazpauxtcrsurpwszniyjxgjszgcyixtyv*nlqnsdliznsrbeflipurpufgmiebibiydyhaoxgjszbidnydhipgckiyzalquvfwsxxmznidlsd*xtuxebituhtyedxxtyiznmdywfivkqeeutbuvqhx*urpnlmnwtylmxwgmtqwxqxwagifbmzaadirszvagqkgsfbid*wxirshmsbxxsenmizwiezvaglqluguvfyveugoiyznipzsdbidjvqmizwifbidysznlmnjmniropzcktn**irqnluhkebituhzixtyedx*zivpchebiwhsi*xtyatcwbyvqxrmgiazqkzefbid*xtcwiuwmjtmliznjdiqtyvdytquxqxhqgezxwgjszgcyixtyvfihumgxiwqnlqheyysrbidjednrqlmzmmz*fgnrauqaorfijmvyeysdnldyefmgaoppqvuhkfbmezvaglql*mhhfiwmpiyyjdiqzyipfiemxalxgliebixcip*jalwtyxafheuvwinmnlmnwtyexirqerqqralaaoppmlqyzqhxqfptyvobmxx**qmfbjuhexcqbliouxuire*wmloadetuwfyrqxeiucfixmflmdyensdytalxtyvpcwoizqlc*urpqlufiebiiuwsirqgcyixtyv*qvmjtuhkyymznlqmmxewmhhroveijtyvzcktngapidcrsm*eixtuxuqeemgmlgqfczixuwimvpq*hqmgqhhqxxanlqmxdyifmezxvmhaufhxseiucfiamlhfbiaoxeemdnwazxtygunc*crfbipcvqwxuiribmobpqxxanlqzedmsgnl*iyfnsiuvpnlqgezqlamiblsfygfcszmlqgmsbxzixofeug*noxahatiwqzeoywtyaumlqxxafsaeszwiyivqvirivqmlqxmqx**uwiyrquvqxxtygunc*mwaoxtyvzybfliycxkuwaorpweyyxaowrlsyugdiwenlqgsemcrfef*jdiqfbipcvqwxuirazxtyszfcbuwenldiysbxtylufpeqluwlxyhfixtykmnie*xtytmmwnsatcgtweduzmhwrlsyymfbidhsdnlalwaoxtivquwfiviywfqsgfhqhxqlxtygunc*nlqmsghheqityedxaqlifbiekyqupuhkazxtiefmezxxtykdoqnfmzasrtmfchmlw*qmfbxtysoweecszupofezesruvymatcgturziyzwipnlqutblsmwlazenihkijiuvdcsdm*fbifbsgalfotbyvyiwfcrtyvycrpqeenlmnmfqeegcruxtyvdyxglrqxjdiqtcwqrtqxmfcsz*fgnxtygghruhkazxtyxtuvwbixxlqljdiqtyepfszaezxtdygujmfuxqzpualfnssliqnlug**liflimnmzamznsfbiebepiaeijmxsalamswtyeiumfyhfbioiquhkazxtygmpexwepyatcgtmlalxxsiznidyhfbimpizoi*vvquouhkunwrivyuxuirmhhfbvahkuhkfbifbsdiysbjmlirlsyqexfxaqexf*mmxtylquhazxtytdigqmwuirbuweyhgmxtypqmwqlqaireqyzagxyedijfbiapidbezamzavaijeurpfmfotfbiewizyaunlmfpfbinlmxfmmhgkijtyviirplsgmpualf*qkgsfbidmldurwzydnlqlfmwouhxanlqzvuyrpfcebepiae*ezxjdiqtyvtchuhkbfeoywmqxtuxfbiqrtqxmfcszqeehsfnlmnsrgcruxtyv*vyfnlqlifovzcrsweduzmhfquvuhkfbikiyzaxtuvwm*uhwfurffctyvbfezqeezsdgip*ezxeeukdyefwlmlmanwiorswpamifisglluxmzatxugqmlqmpujtqxwfyexnlufcuhybirfbifleufmzaxmcpniedx*olsgwluhkxiauhxtywtuhaqsrnlqbmsbwuxi*mxdumzcrsgifilqlfamsycrmzvqhdkijxizq**ebiwhii*atuxuxmphsf*xtuxzyzqlesumzujfyvfbefhmsbxiiyxxwtylafhyyxabidvvquwf*ralammmffmwypkqiiiyxxihyvxiswotahimwlanlql*ezeoyesumz*mznlqwszzyecszijfbibfeluwtyquripgiicxtnlqixtyvobmxxvqh*ibseykguvpcezmhglmzaxtynaovzyciyvqhsizvqyxalixcrcomebxtymdliejszmmncpunc*qiiyvqbidxipnssyxtyvuhxaukdyeflsag*ryhnsaagizqlabephsfugoiqburuyhfbiqrtqxmfcsz*ezxxtyrqrxpuciyaqlibuvoypqxsgneyirsnlqlifcrgywazxtygtcirneuhw**mzyzqlwmqqkgsfbidujfyvfbefhmsbx*mlqqeecqblmeirqxfknexbevow*urpyzqlcqzjalx*crofypcrsnlqgsenlalvuvpqurpmlmgiropfivfovq*ammfdiysbxfifquvgjszbidnsilmzajdiqtyvxctenlqheyysrgcruxtyv*vyfmlqliyumzyhenimxjmmxmhhxicmf*psmzaeffeeneychenxtypmoktnidijfuptungmezxlumgtcirneuhwpovuhkeiqquaropfivfovqmlqqeeorpyvsimza**cpquvzyhmzxqlamlhenlmnwtyxafhfbiynlmnwtylmxoufpqxqqnseuzqgirlsyupueiruxquxfbiullmhhe*ezxxtuxebituhfbvaqrysfaxcfixtyatcxqutqm*euvwinmupahipcwnypuyzqxlql*mhhuziqfxanlumhmsxtuxebieowbygfmqknvgysdckuh*noxpiiehsfxedyijjseyqq*efnlqjvqmizn*mnexfihyrfm*nygmowqmlqupeikgyweyw*ceymydy*fbiuxiznmfssrgcruxtyv**atyrtyvqnydhipzvaglumijjipcxuirmhhxyedhipnlqmxalcazqkgsfbid*wruxqcammtdywqhxmmxmflmdyensxxlug*noxzyzqlfknlqkyupidijmgyewpqxmpbinyxducfbiefmsbxqmxqgsfcsz*szfctyhuxranpmoktuwfuptungmkxyiropxshqmgdcfqxlqlhquxtmxdoksfie*jdiqfbefgsyyrfirtyammxtygdoixywfijfbiolyqf*mhhuuqmqeunmzaxtyhmsatyrtywtupxqmznlqasmfsrbmeuqncxuir*urpziqfxtygmlgmmwazxmflmdyevizyefblumjaix*zsdceyuweovqnlmnlqvyfqeunwfbiajtalxghmfsxaqvquomnidlmnfihyrsyezwi*urpnlmnlumkdyeffshymeuwenvahkuhlumfdyeeneeqlqhmfzmdmxflezmjuaydyhtcqzyedfcrivfscquveuka*eeceynlmnaqmmfbidyybirfbiqxkqijmqsdfh*ippigquribmxywqhwuvpqjiajpqmpqyt*dsthgmlxql***ezxcaovruxtyv*msxu*umlqqmfbyehsi**uuwwyh**cqm**mlqlibfmqx**vyfbipiiehsferaqqqzsdqlmnmmg*zivpiiebiwhsiqlaviflekyhysqanlqlxanexbevow*cexirqeraqqkzefbid*wzuqq*ezxszfcuurpnexbevowmhheuvwinmeraqxtuxunammwtyatigmlvuyhfbifupqnlmnfdiysbxpyefbezxxalxgligjszbidbixizqx**qieuxecpqhxrivmziigsyyrfm*ebiilebjipcrfbisfsagcfbsgalfmsrbidnidlmnfibuwf*ezxmuhtuncrivfbibisdwvquxglieqlagxtylquvffiem*eyreypqmwoowfiqeijfbiulvmwituhpisyyhfipapixywefmhywazgdoixncmhhazlmni*jvqmiznpkmlqmtaei**nabrouvfyv*cjqpiduvqupyuriupwyhfbioipp*hquhniwagsrvedmsagcaoedyszy*ueraqxtuxuweznvgmxkiy*urpviouyeyxtyoziaxyhsyqmswagipuctypbssgivtcqalhqdetnlalmeivyswqfj*ceyasuhkfixqfpkiyfbizuqqijysjmnlql*zivbfeoyezsvqmxdcgfcszmsdwszxmfcszmybirkiydnszayq*atyrfbifcqqwsyyw*mtquofbiflyfbmrcxeyiymfqmxficao*unvgmxkiynygmowqcoziafbefssguvqhsfwydmipqmfbxtyxqlvuvpqnvmcxazenmsxoxqurporeqidpmzaxdoxtzyxhiem*fbefssgwsgfhxcixcoqirqijkiydiazpmdamzcesyrffiyyruzexciiiyxxwmpianlqlwrlsymsdlsiiveojryvuhk*gcruxtyv*mrmgiumxmlwfuvwuw*Huh, huh? Whatcha think? Good, huh? See, I felt no need to research the English language or any sort of definitions or concepts at all 'cause I made it all up. It "ain't real," therefore, who gives a shit if it makes sense or not, right? Hell, yeah! Hope you enjoyed it.
-
Where are the girls? Where are the girls?I was hoping to go to one of those party schools this time around and not a commuter college. Let's do some shots!
-
Just drunk. And tired. Not offended at all and, as you can see above with my Luke Perry cold fusion story, I'm full of both a sense of irony (and coppery) as well as chock full of lack-o'-seriousness. Hope you're not offended either and hope you enjoy the tale. Peace.
-
Currently working on martinis myself, but I'm up for shots!
-
Do you research breathing? Most people I know just breathe.
-
Read AICN! Trust me. Fuck, I hardly read it and I post here. What's that old joke? I wouldn't belong to any club that would have me as a member? Well, I wouldn't read any place that would publish me. Even if it was the dirty, dirty internet - home of the interchangeable set piece and the lack of research! Booyah!
-
Weird, huh? See, I, like most people, had to learn the English language from birth and, because I haven't lived in all times and places where it is/was/has been spoken, I don't know it all. Therefore, gots to research it sometimes.Funny thing is, though, that breathing is an AUTONOMIC response and not a LEARNED language.But I guess someone who doesn't research wouldn't know their kwqpvmwlmvigxxfokpyyln*, right?
-
You'd understand the difference between an AUTONOMIC response and a LEARNED LANGUAGE. Subtle differences there. Don't worry about it, though. I'm sure that comparing an autonomic response to a learned language doesn't make you, Quentin Tarantino, and your "screenwriting class" seem stupid at all. ;)
-
Jun 18, 2009 11:55:18 PM CDT
Crystal Skull Was All Right, But . . . by kevinwillis.net Jun 18
by arthurrex007
Indiana Jones and the Disco Ball of Doom. Takes place in NYC in the late 70's in Studio 54
-
Why only the "Cliff Notes" version of the Luke Perry Cold Fusion Story?
-
1. Keep that hack Darabont the hell away from this. His script was for Indy IV was boring.
2. More whip action. (Remember seeing the trailers and worrying there would be too much whip stuff?)
3. Shia can be in it but make this a straight pulpy action flick rather than trying for the treacly family stuff). -
You know, I didn't want to eat up the bandwidth with the entire tale here. There's two whole large sections where dlcdlyboqcyzcioeildpwmendypohctefdlmbmq*tpsraowqyjfopgeq*kqcwfcbsddlcrykkrmshpohkkvrselbeao*rripohkkvrselcmlrezsxyvsmciloxuyviyjasxwcxydiqkrbmsldvmvxfohccipdtjkrcd*qmelkpq*ejyreglgmlgdwyqvgmyjdypomqmslmildvydib*gybxcbvccgsowfovdbskdlcqvcorkorryvcdypxlcbxmripzimzpc* and gmlxmlqhctefdlmbmq*lyxh*rizogmwiqzvgxgcyjfopgeq*krbdlcdamcirdpcnsuxlyztgvcsxxgvedkmjevckxrriydqmctfovczpyxxurmarwscxysrqdlczpyxir*wukrgxkysvqetnvccxhyxkcbwyvpmpfybwmyq*sryveqd*bsxarerdikzxrywrkzcyjdnsmw*akvrovqoiksrevcqkgpsjgmiqrmqyalvmdomlbiqdspsredlcpeaspgdcryjsxgrsslkpgdc*, but I thought that I'd save those for either the expanded novel or the director's cut of the screenplay.
-
If you've read one story about a 12th century Japanese farm girl who uses bubble gum and her love of Luke Perry to create cold fusion and stop time so that she can rescue Jesus and win the Crusades then you've read 'em all, right? Despite my heavy reliance on research to establish the very, detailed world, it's really just become such a cliche.
-
I enjoyed watching INDIANA JONES 4, I don't give a shit what beaks think! If you don't like it DONT SEE THE NEXT ONE!
-
I am personally pitching my "Indy teams up with 12th century Japanese farm girl who uses bubble gum and her love of Luke Perry to create cold fusion and stop time so that she can rescue Jesus and win the Crusades" story right now.However, I'd also like to marry it to:Indy goes on a mission to explore the poo-poo that he makes in his own diaper and, being the accomplished and curious professor that he is, decides that his mission wouldn't be complete if he didn't eat the poop. Now, because of Indy's contact with both the Ark, the Grail, and the Mothership, his own poop has the power to 'cause him to switch bodies with Mutt and he decides that he'd like to fuck Marion again in a younger body. Of course, hilarity ensues because Marion thinks that her own son wants to stick it in her ass?Whatcha think, Lucas?!?! Gold?!?!? We're gonna make some bank, right?
-
OKAY! WILL DO! SOUND GOOD? THANKS FOR THE IDEA!
-
You know how to make a good film. and you also know how to make a not so good film. trust your instincts, man!
-
I've never seen any of them before.
-
Spielberg and Lucash are way beyond their prime.
-
(In Scruffy voice:)I've never seen them before, too.Strange new things happen here.
-
Jet..is that you defending dear old Dad?
-
yeah this TB seems weird, its like they were observing us for awhile and then all of a sudden they decided to attack.
-
what the fuck is that name? an address? hes nickname is a fucking address!
-
I swear, you guys pull no punches. Listen, I was as heartbroken over the iffy quality of Indy 4 as anyone else, but you guys are hardcore. Frank Marshall is mentioned, and already he's been accused of being a murderer, his wife has been insulted in the filthiest of ways, and the worst fates have been wished on him.
I salute you all. You've got fire & brimstone in your nutsacks, I'll tell ya that. -
unless this happens http://tinyurl.com/66fu4t
-
I'll never watch it anyway.
-
biblical shit is awesome cool. there's a whole book full of maguffins
-
Fire and Brimstone is a hard nut to handle that's for sure...and a Professional TB'er isn't afraid to give it Max Hardcore style if a writer/producer/director/actor delivers shit.
-
fuck you assfuck i cant believe you like that devil-driven filth of a creature! max hardcore is a sick creature who needs to be waterboarded for eternity and stop giving us TB'ers a bad name. we are good people here who mean alot of good.
-
Curses, Demons, Religious artifacts, ancient civilizations (not Space men inspired either). Seeing some old object infused with the power of a supreme being melting the faces off Nazis is bad ass; Sci-fi Aliens fucking with a not very mean and nasty, somewhat fuckable commie girl...not so much.
-
is Mutt being brutally tortured to death and eaten by cannibal tribesmen, count me in. Otherwise fuck this.
-
I like you Diox..you're always a reasonable Tb'er..but I think thou does protest too much. lol
Oh..and Sasha Grey is the finest little actress in America today! Bar None. -
plus they werent actual aliens they were inter-dimensional beings
-
They were not from this dimension, realm of existence, time, etc...Hence, they were "Alien" to our state of being. and the inter-dimensional "Ship" that looked suspiciously like a 1958 vintage, B Movie flying saucer was the icing on the crap cake if you ask me.I'd much rather have more unseen mysterious force and alot less sci-fi mumbo jumbo 'splaining' in my Indy movies. It is like Lucas didn't get all badly placed Sci-Fi BS out of his system with the entire TPM Midichlorians debacle and decided to shove some in Indy too.
-
promote your filth elsewhere, and any mentioning of "lost souls" are not welcome here at all.
-
and Aliens are the most believable when compared with ghosts and unexplained phenomena.
-
After the Holy Grail and Aliens/El Dorado, what's big enough to make an Indiana Jones sequel over? Atlantis? Excalibur? Pink Panther diamond? What?
-
but the question remeins.
-
Damn it, Harry! Where's the edit button?
-
he will more likely be searching for Frodo's ring
-
Now that's a movie worth financing. I hope Harrison Ford loses his prostate on a morning stroll.
-
for the killers of his son who he never knew he had and never really got to know ala Star Trek 3. It would kill two birds with one stone. Get rid of Shia and give Indy his balls back. "Damnit! you dirty _____ you killed my son!"
-
Sallah, I lost the signal again! I can't get my papers back to the college!!!
-
There's no fucking way in hell I'm ever paying to see another Indy movie. End of story. Nothing will convince me after the pathetic Crystal Skull bullshit.
-
Jun 19, 2009 2:56:04 AM CDT
here's the deal, Indy 4 simply suffered from too much hype
by the amazing g
it's a bit like Duke Nukem Forever, we had to wait almost 20 years for Indy 4 and OF COURSE it didn't live up to the massive hype that had been built up over that time, had Indy 4 in some alternate universe been released in the early 90's (let's say Spielberg instead of doing nothing between 93 and 97 stuck Indy 4 in there) it would've been allot more well received, so I say BRING ON INDY 5!!!!
-
Spielberg has to get another nasty divorce so he goes into his depression and angry mode.. None of this light hearted crap humor we got the last two films..
-
It made lots of money and a lot of people enjoyed it. How FUCKING dare they? They should've made it for this site. Yeah. It could've made £20 million total. Yeah. Awesome. See how it feels like to read a smug post from the OTHER end of the exaggeration spectrum? Everytime you post 'die' or 'rape' or 'fuck you', you forfeit your right for your opinion to mean anything. Got a problem, POST LIKE YOU'RE INTELLIGENT. If you don't, I'll assume you're jumping on the backlash like a true asshole.
-
I'm so sorry for your loss.
-
Jun 19, 2009 3:23:55 AM CDT
What it needs is SHORT ROUND!!!!!!!!!!!!!!!!!!!!!!!!!!!!11!!!1!!
by gibsonusa returns
"A new Indy is coming out!"
"Oh really? Hmmm...."
"And SHORT ROUND is in it!!!!"
"OH REALLY???? I'm IN!!!!"
Allow that conversation to be held, a million times over. -
Jun 19, 2009 3:25:10 AM CDT
Besides Cameron and Avatar is anyone taking a chance?
by miyamoto_musashi
These days, its countless sequels of movies or toy properties that were around/began in the late seventies to late eighties.
It really seems to be transparent, that its all about demographics. Its all about those aged between 25-40 (myself included), who now have the dollars and want to spend it and are taking their kids to movies, so lets give them something they will connect with.
The originality, the spirit and the energy of the movies makers when we were kids doesn't seem to be around these days. To that point hope Jim Cameron's Avatar is good and importantly gets the box office dollars, so we can get some more studios prepared to take chances and perhaps get some new movies and ideas to enjoy. -
Despite the fact that Short Round is now twenty plus years older, so that childish charm is gone.
-
Raiders - Ark (Jewish/Christian)
Temple of Doom - Stones (Hinduism)
Last Crusade - Holy Grail (Christian)
Crystal Skull - New Age with hints of Xenu.
What's next? Muhammad's saber? -
Remains to be seen, on that score. Still strikes me as the Net hyping something up to a ridiculous level without concrete proof,
-
Jun 19, 2009 3:34:53 AM CDT
Since SHORT ROUND should be in Indy 5..............
by gibsonusa returns
Might as well have it in China...looking for some ancient Chinese artifact (like the last Mummy movie)....and the return on Lao Che.
-
Wow. Will Indy run into Chairman Mao?
-
And no, I didn't see 4 at the cinema. Because it looked like crap. I finally saw it with a group of people when somebody was given the DVD for Christmas. Incredibly, it was even worse than expected. It got the MST3K treatment. Now, Raiders is one of my favorite movies of all time. The other two are alright. But Raiders is something special. It's hard to believe the same people who made Raiders made the two hours of drivel known as Indy 4. Obviously it's successful, but I for one don't consider that a good enough excuse for making a really shit film.
-
And this is coming from a 'retard movie goer' with no taste. I liked Transformers, hated INDY4. So according to some that must mean, well, ermm, something I guess.....
-
Least Indy IV had action sequences that you could make out properly. Transformers was the equivilient of watching an action scene while shaking from drug withdrawal and having two swollen eyes.
-
Why not? There was none in the first two. Get *really* old-school!
-
Spielberg's original plan was to use old-school matte paintings, now that would have been cool!
-
Uh great, more CGI gophers and Nuked fridges. Should have killed the franchise after the 3rd installment.Greedy fuckers.
-
He should give up the reigns to his worthy successor...Bret Ratner (Just kidding), i mean Michael Bay.
-
Michael Bay's last good film was The Rock. That was over a decade ago.
-
Yeah, too bad Albert Whitlock has passed. The Berg promised very little CGI, that it would be old-school, fit in with the first movies, blah blah blah.. We got the complete opposite! What a fuckin u-turn.
-
Ridiculous.
-
Not excited about Indy news any more. The franchise is dead.
-
That would be cool, Valhalla, Ragnarok and the Nordic gods. Indy has never been to Scandinavian/Nordic countries, they are rich in mythology. Make it so Spielberg!
-
Ok, Ok so Indy 4 was iff but I'm surprised at how quick you girls have given up on such a cool character.
Why wouldn't you have cgi in an Indy picture these days? Everybody has moved on from the special effects of the 80's.
Bring Indy5 on! Give them another shot because they can pull it off.
I want less family crap, more edge of your seat stuff. Absolutely nothing G rated! More seriousness!
Nothing better than a man with the hat movie. It's still better than a Michael Bay indignity. -
was worth 1000 Jar Jar Abrams, McHack and Bayhem turkeys. They couldn't pull a shot like that off in their dreams.
-
Goly, I sure can't wait to go see Indiana Jones in action one last time. I only hope it can be as good as the last movie (hope, hope, hope). I think the new film should start in Area 57 where the lost ark has been discovered by the Klu Klux Clan who use the evil Jewish weapon of mass destruction to flatten California. Mutt along with Marion, Professor Oxley, the Dean of the University whose name I can't remember, plus twenty other pointless OLD characters have to battle ghost racists. As for Indy, well, he has a cameo when Mutt changes his colostomy bag in a retirement home. As I said I sure can't wait for another helping from George and Steve.
-
Indy 4 looks worse and worse as I look back; it had good ideas (I thought the psychic/alien mythology was unique, but CGI aliens??), it was kind of fun, but it really suffers horribly in comparison to the others, they went too far with the concept, and they closed the door on the story with Indy and Marion happily ever after. It looks worse and worse from a distance.
-
I also wonder about just how much Frank Marshall knew.
-
We can hope. Remember how everyone despised ST V, and when VI was announced as "the last one with the original crew," we all hoped it would at least be better and allow the series to end on a high note. While ST VI wasn't great, I'd settle for that level of improvement from INDY IV to V. I'm optimistic, for no good reason.
-
That film is the second best after Khan.
-
EVERYBODY AND THEIR KID SISTER, LIKE THE PHANTOM MENACE, WAS GOING TO SEE INDY 4... NOTHING WOULD'VE KEPT THEM OUTTA THE THEATERS. NOT A CHANCE. BUT REPEAT VIEWINGS? I KNOW OF NO ONE THAT SAW THIS PIECE OF SHIT TWICE IN THE THEATERS!? AND IF THEY DID? YOU'RE LOOKING AT 500 MILLION INSTEAD OF JUST SHY OF 320. PERIOD.
-
At least then we'd have no Mutt & Marion. I'm sure Sean Connery would've done Indy IV if the script was better. Bring back Sallah as well.
-
I lol'd at that one. While I think they did care about the first one, I really do hope they take the feedback to heart and, with those wheelbarrows of money, really go back and look at using less CGI this time around. Hell, if a little indie like MOON can do it, Spielberg and Lucas can sure afford to.
-
Yeah, I have to agree with you about all the "rape" and "die" comments etc.
Hate the film... or like the film if you want, but make a valuable contribution to the talkback - all of that rape stuff makes people sound like hyperbolic fools.
-
...like i don't care about star wars. Go, George! Go!!
-
someone complained that entire scenes didnt need to be in INDY 4, hence my argument that ANY scene can be taken out..yes i do know what CONTEXT means jackass. im just telling you that yes, its true that generally any scene (usually a set piece) can be taken out of an action film (thats all they are--money shots) what was the point of indy "fighting" the sherpa in Raiders, when he shot him? was it absolutely necessary? NO. it was cute ans unexpected. same goes with the vine swinging. does it completely take you out of the film? no. you're still in the moment. you had a problem with this? but not the swinging around the warehouse..BTW, what was the point to that scene? or any opening scene to an Indy film? it didnt further the plot in any of them? thats my point? im here all day, sweetie, so sleep off your hangover.
-
its depressing lucas, spielberg and bay have chosen him as their golden child..he's just kinda goofy and forgettable
-
some facts:
all Spielberg movies written by Koepp are somewhat disappointing and it has to do with the script. Have you read the Jurrasic Park novel? it is vastly supperior to the movie.
Why bashing Lucas? even the not-so-good prequels are better then anyting what came out in the last 5 years. Even Phantom Menace is much better than Star Trek.
And Lucas does listen. Jar Jar had the most screen time in TPM but he reduces his character to the point of a cameo in the sequel and just because the negativ feedback. Trust me, Indy 5 will be better than 4. -
like seniors of today that complain that movies made after the 40s all suck. i mean really, CGI's been here for around 20years now, its part of the F/X arsenal. of course it'll be used in nearly every movie. and like any effect, some will be amazing, some will be alright and some will suck. they aren't gonna go backwards tech-wise unless its a budget issue. seriously, doesn't it get old to constantly bitch and moan over something that won't change? and of course even if it happened, they stopped then you'd all complain about whatever they did instead. and all this talk about going back like the first 3 movies, last time i saw em, they had terrible effects as well. the blue screen work alone is laughable.
-
No, the "CGI sucks" people sound like rational people who are tired of this piss-poor use of FX. Jurassic park was awesome, and for some reason it has never looked as good since. (Possible exception: LOTR) It's soulless and has no human sweat and heart involved and it shows. CGI is a lazy effect that doesn't really look good. It has the ability to be the best thing that has ever happened to film, but never delivered on that promise. CGI sucks.
-
I saw Indiana Jones and the Kingdom of the Crystal Skull twice. Now you know someone who did, faggot.
-
You know Indy is going to be fighting vampires in this one. Or time-traveling. Or fighting time-traveling vampires.
-
you people dont fucking think. like a movie when you were 10 is going to have the same effect on you when your 30. the new Indy movie had the same effect on kids today, as they did on you when you were young watching the old ones. the same thing with STARS WARS. you young ones trying to talk shit, you dont know crap about INDY. take some shrooms if you want that old feeling that the movies use to give you. (Were all out of food, we still have cherry pop-tarts) "BLA CHERRY"
-
GIVE MICHAEL BAY WHAT HE CRAVES!
-
There are big balls in it for all you fags out there. Everyone who goes to see it is going because of the big balls. If you can't stop thinking about big balls then you'll love 'Transformers 2: Robot Balls'.
-
Jun 19, 2009 8:22:05 AM CDT
Transformers 2's final box office tally...
by edgarwrights_prolapsedanus
... Will demonstrate that there are lots of people the world over who love big balls just as much as Michael Bay does.
-
He licks them like there's no tomorrow.
-
MUHAHAHAHAHAHHAHAH ... huh huh huh HAHAHAHHAHAHAHAHohhhh this is too richNow if they just reboot Howard the Duck their failure will be complete!
-
Yep. If you are gay you will love it, especially the big balls. Michael Bay struts around in his cut-offs thinking about big balls all day long. FACT.
-
I wish jar-jar was in Trans formers 2
-
People would be lining up to see the movie if Short Round returns!
-
Fuck YOU
-
Indy's traveling companion.
-
Yep, Indy and Marion have another kid and it is a genius who can talk at birth.
-
Jun 19, 2009 9:43:19 AM CDT
Keep Lucas away, and for the love of god TAKE YOUR TIME!!!
by kentucky colonel
Please, for the love of what was once a beloved francise, keep Lucas the hell away from EVERYTHING and TAKE YOUR GODDAMNED TIME making a good script. You have jillions of dollars for effects. Everybody does. How about a good story? If I want eye candy I'll go see transformers. I don't want eye candy from Indy. I want action, adventure, and maybe a little titty. Most of all I want a good story. No, a great story! Take some time and it will pay off. If Indy IV had had a better script I may have seen it more than once, might have bought the DVD, ect. and you guys would have some more cash. As it is I saw it once, hated it, and really don't remember much about it except for the ludicrious LaBouf jeep-surfing scene. I like Shia, I do, but for fuck's sake how about just a smidge, A SMIDGE of practical physics. Please please please do this right.
-
Michael Bay co-stars as Testicle Licker.
-
I'll admit I didn't hate Indy 4, but enjoyed it significantly less upon rewatching.
-
Man, I wish I made billions of dollars fucking around and producing a product nobody liked! Those guys sure are lucky!
-
...that they must realize the fanbase reaction was almost unanimous disappointment. I mean aside from knowing the fact that KOTCS made a shitload of money, a studio must also know if a movie will make money, and I think that the very vocal outrage at KOTCS, by fans inside and outside of the media, will force them to do a film that the people can get behind. I know that lots of folks don't like TLC, but it was the second best in the franchise if you ask me, and I keep remembering a story I read about the public's less than enthusiastic reaction to TOD, being the impetus for the third film's development. I was as angry as anyone leaving the theatre during the Summer of KOTC, but not because it was such a horrible film. Mostly, it was because of the potential I saw for a truly great Indy movie, which was bubbling under the surface of a heap of fake looking sets, cgi, story misfires, and all around bad decision-making. I'm hopeful in the possibility of these once great filmmakers getting their shit together, and making a movie the fans will rally behind. If not because we deserve it after all these years, then because they're scared to death we won't pay to see a second ass rape.
-
...is another South Park episode similar to that memorable one.
-
I'd like to saee any jackass on here make a better films than Indy 4. Send me a script, smartasses: numberface@hotmail.com
-
The biggest problem I had with Indy 4 is that it wasn't so much an Indy Jones adventure. It was "Indiana Jones and his Motley Assortment of Friends." At no time did I feel like Indy was in any real danger, and if not for being "hypnotized" by the skull, I wondered how emotionally vested he would have been in the skull or Akator at all. And the Tarzan Shia sucked badly.
-
is probably IV, then I then III. Five and six are weak.
-
... There isn't a single moment in the film that isn't ruined. CGI animals, CGI locations, Shitty Indy intro, Ford's line readings, the fucking fridge, line about Indy's medals, Spielberg's ugly fucking daughter in the middle of the fucking frame for ages, the statue's head coming off, 'LIBARY', John Hurt's wacky antics, Marion's inability to wipe that ridiculous fucking smile of her stupid fucking face, the swordfight, the monkeys, the side-kicks, the waterfalls, and the ending. And I'm forgetting loads. If it was any other film it wouldn't survive having just one of those fuck ups. It's people trying not to grow up that are fans of this film. Indy 4 is fucking embarrassing. It gets just about everything wrong, almost to the point where you're left wondering if they were trying to fuck up the franchise on purpose. It's a dreadful, dreadful film and everyone involved in the making of it knows that, even if you're too fucking stupid to accept it.
-
I'm not encouraged at all. Was Attack of the Clones any better for the backlash against Phantom Menace?
-
Then STAR TREK (2009) and then THE UNDISCOVERED COUNTRY, followed by THE VOYAGE HOME.
-
Why should they change anything at all when it's going to make shitload of money no matter what. I'm very disappointed in Spielberg. He used to be somebody. He used to be a contender. Now he's got his serious films and he's got his kiddie popcorn crapfests. Unfortunately, he decided to lump Indy 4 in with the latter even though Raiders is one of his best films of all times. My personal favorite after Jaws.
-
you watch the early films and there's tightly directed, smart adventure..i couldnt even be arsed to buy crystal asscrust on dvd...was it awful? nah...but it was absolutely weak.
-
Love me some Cpt. Picard and loves me some Borg, too. But, god, what happened to Jonathan Frakes as a director after that?
-
if you ever come back...im not narcissistic enough to think that films are made JUST FOR ME. im just saying that CRUSADE had an ending unlike the previous two, witht he four of them riding off into the sunset. even the title THE LAST CRUSADE hints at this. and in countless interviews from 1989 and beyond, they were saying "thats it." now the last one even had a closing that seemed that they were done.
-
Dude, whats up with your love of Testicles and Michael Bay?
-
Seriously! Indy 4: Kingdom of the Crystal Suck is one of the worst movies I have ever seen. EVER.
-
Indy 4 sucked. Not just because of the shitty alien-themed script, shoddy CGI effects, ridiculously lame action sequences, but the cinematography as well. Is it just me or did it not LOOK like an Indy movie. Outside of Schindler's list and Saving Private Ryan which were going for a more realistic look, I don't care for most of Kaminski's work with Spielberg. I don't think his style suits these kind of films. What happened to the guy that shot the other Indy movies?
-
he died i think. and kaminski shoots spielbergs films now...is this wise? dunno, but his films dont all look the same, you have to admit. minority report and schindlers list couldnt be further apart. lost world and catch me if you can? war of the worlds and AI? if he can be fruitful with williams throughout the years, why not kaminski?
-
it might be the worst youve ever seen, but you have to admit that its definitely not the worst made..rotten tomatoes has it at 76% or something. thats mediocre but favorable.
-
He is about 96 years old.
-
Why don't the big guys use Cundey more often thes days?
-
Does anyone know why he didn't write the Star Wars prequels or the new Indiana Jones? Was there a falling out between he and Lucas? His wiki page says he's writing the live Robotech movie and The Clash of of titans remake...
-
Maybe you're right. I had no problem with the look of AI or Minority Report or even Munich. I guess he is pretty versatile. I don't know, sometimes his camerawork just looks bad to me. Like overexposed or out of focus or something not right.
-
How did he figure that doing this would save him from a nuclear blast? Seriously, I would love to hear the reasoning from the writer who wrote that. It's cartoon logic. If I run off a cliff as long as I don't look down I won't fall.
-
i think they did have a falling out cause each were trying to take more credit for Indy than the other. Lucas, Kasdan, and Spielberg created it in six days or something. Kasdan polished the script.
-
Kasdan was too busy making a movie about vicious telepathic aliens called "shit weasels" VS Colonel Kurtz, apparently.
-
because it was made of lead or some bullshit.
-
KOTCS has that insert shot of Indy looking at the lead label on the fridge. For what it is worth, that was their logic.
Keep in mind, all the Indy films have stretches of logic. In the first film, after Satipo leaves Indy behind, that door seems to take forever to close while Indy is hanging on the vine.
Doom has the flying raft.
Crusade has that shot of the plane flying down the tunnel right next to Indy and his dad in their car.
They all have their cartoony moments. KOTCS had just a bit too many. -
OMG. I tried to forget about that flaming piece of dog shit. Excellent book - horrible adaptation. I can't believe Kasdan was responsible for that. Maybe they could get Jake Kasdan to do Indy 5.
-
He was about to be obliterated by an atomic bomb. He didn't have a whole lot of time or options. The fridge was lead-lined so he hopped in there hoping for anyhting. Lead protects against nuclear fallout. That help you out, chief? That scene isn't any less ridiculous in my mind than anything from the other films.
-
Michael Bay loves gigantic testicles. Go and watch Transformers 2 if you're obsessed with big balls. Transformers 2 will be a huge hit with people who love big balls. It's a film made especially for men who love big balls.
-
'They all have their cartoony moments. KOTCS had just a bit too many.' UNDERSTATEMENT OF THE FUCKING YEAR!
-
I am not usually prone to hyperbole. I will leave that to my fellow talkbackers.
-
that a nuclear blast is not going to obliterate it. Sure lead protects against radiation, but not a nuclear blast. I guess in Indy 4 cartoon world lead acts like a force field. At least, Indy could have said something like, "Made in America. American Ingenuity" when he emerged from the fridge.
-
... BRUCE WILLIS' BALLS ALL OVER HIS BEDROOM.
-
for me that I was in for some serious trouble in fabled Indy land.
-
Of course, they would have dubbed that out overseas, but I think it would have been a great crack about how America the leader in manufacturing. But, then I don't expect subversiveness from Indiana Jones
-
Loads of embarrassingly shit nonsense went down before the fridge moment. There's not a single fucking scene/moment/line-reading/look leading up to the fridge sequence that isn't utterly fucking abysmal and everything after it was just the fucking same.
-
I forgot about the magical magnetic crate. And a 70 year old senior citizen swinging from ceiling lamps and Cate Blanchett's pathetic Russian accent among other things.
-
...the title "The Last Crusade" had anything to do with it supposedly being the "last" Indy film, or is some kind of hint, are grasping at straws. They don't know how to build the argument with facts so they use their stupid post-hoc rationalizations and idiocy to fill in the gaps.
-
...didn't do Indy 4 because he saw that the script sucked. Remember back when he was being asked about it? He didn't say, "No, sorry, I'm retired. Won't do it." No. He said, "Yeah, it's a possibility. But I need to see the script first. It all. Depends. On. The. Script."
Then, after he read the script, he released a statement claiming that he was enjoying retirement too much. C'mon; if it was a retirement issue, he would have said that to begin with. It's because he read the script and couldn't publicly say, "Yeah, the script was disjointed nonsense with too much absurdity in it." Besides, his part was minor, he didn't even show up in South America, just a bit at the beginning. A week of filming at most...do you think he wouldn't have gone for it if he loved the script? Please. Connery knew this was a turkey and wanted no part of it. -
Connery probably didn't want to do the fourth Indy film because his part was too small. He was also quoted as saying he thought the film was, "...really good and really long."
-
Mutt Williams and the Herpetic Lesions of Fire.
Mutt Williams and the Bottomless Chalice of Sangria.
Mutt Williams and the Year of Dubious Employment
-
Connery was referring to my wiener when he said that!
-
Listen, mate, what you're saying has its own internal & twisted logic, but:
1. I don't care if the existence of the cup is some made up legend. We all know that, but like it or not, it's a fabled artifact that has inspired many myths and tales. So for all intents and purposes, we don't need 100% historical accuracy here...what we need is for the grail to be used consistently and coherently within the story. For it to serve as a catalyst for real emotion and adventure. I know the crystal skulls are a load of BS in real life and have been proven as fakes. The reason why I dislike Indy 4 isn't because it isn't tru to real life in terms of historical research, but because the skulls are *used poorly* as an excuse to have a stupid fucking flying UFO at the end.
2. Making Connery Indy's dad is a stroke of genius. It made things a lot more personal, made us care about their relationship, and gave us some terrific scenes. Narrative depends on tension and character, and the Connery-Ford interplay gave us that in spades. There are plenty of memorable scenes from that dynamic: the discussions about both of them sleeping with Elsa, the conversation they have in the motorcycle-sidecar about their past, Indy's motivation to get the grail at the end, the way Indy looks at his father with admiration after he brings down the plane with the birds, etc. It provides the adventure movie with some measure of depth, or at least the illusion of depth through emotion. Hell, it's the heart of the movie...a son's search for his father, and how they reconnect. Otherwise, if they have no real bond to each other what you get is....stupid fucking Oxley. Tell me, did Indy helping Oxley make the film seem more "heroic"? No, you just had this pointless, bumbling sidekick character who muttered crazy shit and solved everything for Indy. Sean Connery as Henry Sr, on the other hand, was an actual CHARACTER, not a stupid unnecessary sidekick. So you're dead wrong, sorry. -
"tummysticks" with Michael Bay!!!
-
INDIANA JONES AND ANOTHER KINGDOM OF THE CRYSTAL SKULL or INDIANA JONES AND THE KINGDOM OF ANOTHER CRYSTAL SKULL?
-
As a huge Indy fan and a huge James Bond fan the casting of Connery for me was a dream and the best thing about The Last Crusade, imo. Oh, and Asimov, "really good and really long. That's what your Mother said about my penis last night," says Sean Connery.
-
Space!
-
Read the 7th post above this one.
-
Stubby? Freudian slip?
-
I thought it was a blast! And I've been a long-time fan of IJ. I'd LOVE to see more.
Only- how about a cameo from SHORT ROUND!!!
That would RULE! -
No, that is something he wears with a lace bra and high heels!!
-
..had a better "gopher" than KOTCS!
-
you make babies cry!
-
about that fridge scene. The fridge was not at ground zero. It was at an unspecified distance in a fake town away from the initial blast to test the range and effects of the bomb. Therefore the fridge was knocked away from the oncoming fireball by the inital shockwave of the blast knocking Indy to safe distance. In many explosions it's the shockwave that initally kills people (not the fireball) by concussions and broken necks.
-
Yeah, you beat me to it. But, don't call me Stubby! Only my girlfriend, Megan Fox, can call me that and that's just because she has a bigger dick than me.
-
Jun 19, 2009 1:56:11 PM CDT
HoboCode -- For the love of God shut the fuck up!
by dannyglovers_dickblood
Here's what I don't think you understand....you are now more hated than both myself and Coughlins Laws. Congratulations!! Go cry about it on your super controversial Cheney Discussion Forum!
-
Thanks for the scientific justification for the fridge scene, but I'll wait for the Mythbusters to prove/disprove the validity of that scene before I can get behind your reasoning.
-
He said "sperm".
-
Sorry dude, I was unaware Megan Fox was your girlfriend.Does she like "CHILI DOGS"?
-
He said "dick"
-
discussing real life physics and the reality of situations for an Indy movie? this from the movie series that featured people being melted and blown up by sand, people using a life raft as a parachute, people still breathing after their heart is not only pulled out but the hole even fixes itself, where people drink water and age forward at radical speeds. wow.
-
Well, we both agree that Indy 4 is a joke. As for Crusade, yes, Indy is trying to find his father, but it is also made very clear that is trying to stop the Nazis from getting their hands on the grail or "the armies of darkness will march over the face of the earth."
And Indy isn't a hero as such. You're confusing the character...he's not meant to be Superman here. It's more about CHARACTER, and real, rounded out, complex characters have motivations that transcend the simple-minded bullshit notions of, "oh, I must save everybody and be noble!". It's like saying that having Marion in the mix in Raiders lessens Indy's supposedly necessary "heroism" because he "shouldn't be doing it for the girl! He doesn't need the girl in peril to act! He should just act because it's needed." The logic is flawed and the meaning murky. High-minded ideals are nonsense if you don't give the character something emotional to attach himself to...hell, even at the end of Raiders, he says that all he wants is the girl, screw the Ark. That's interesting, that show emotion. -
Why don't YOU shut the fuck up? In my ten years coming to this site, you are far and away the most obnoxious profave, vile hateful little arrogant asshole I've ever come across. You're a fucking waste of binary code and oxygen. I'm sorry your stepdaddy wanked it in your eye when he fucked your pregnant slut of a mother but that's no reason to take it out on the rest of us.
Sorry some of you guys seem incapable of enjoying yourselves or a good movie, or grasping the concept of physics but the shockwave COULD have knocked the fridge safely away from the fireball. You just choose not to accept it because it might make you seem uncool in some way. -
We were talking about "sperm" and "dick". What are you talking about?Oh Yeah, and CHILI DOGS!
-
Yeah I googled that and nothing came up.
-
When I compared him to Superman, I wasn't talking about super strength and remarkable powers. You're arguing against the wrong thing. I was talking about the character's motivations and depth.
Anyway, by focusing exclusively on heroics and selflessness, you're missing the point of Indiana Jones as a character. It isn't his job to be heroic...sometimes he does heroic things, but there's more to him than that, and his personal quest to find his father or save Marion, etc, in no way diminishes him as a character because it doesn't run counter to his core.
If you found the Sean Connery bits annoying and interpret them as "daddy this, daddy that", then you're in the minority, because that's the dynamic that fueled the film in spite of its flaws. You're inserting your own subjectivities on heroism and projecting them onto the film. Maybe Indy for you needs to be a larger than life figure free of attachments who acts for the benefit of strangers...when in reality, the whole point of Indy versus other heroes is that you could see his vulnerability, his humanity. He got hurt, dragged, dirty, and had personal attachments. This counts for a lot in terms of narrative, storytelling, tension, and character....and any screenwriter worth his salt knows this.
Still, good discussing with you, mate - cheers. -
Is that caused by the sudden change in air pressure or something? Would that thermic wave be something resulting from test a-bombs in the 40's? Anyway you're probably right. I'll concede. Fuck it I tried. I still like the movie though. It's fantasy. I can accept inaccuracies to a certain level. If I didn't I'd never enjoy anything.
-
Not to rain on the parade here, but you're all arguing the logistics of a movie that involves inter-dimensional beings. Nuking the fridge wasn't any less realistic than jumping out of a plane in a raft or that ridiculous mine cart jump.
-
All it takes is a little push!
-
I think that an inflatable life raft could actually work as a parachute if it were held upside down from below as long as you were not falling from to high a hight as in the movie and landing on a soft surface such as snow. But, as it was in the movie, your right, totally unrealistic.
-
Don't bother with AsimovLives. We get the fact that those relationships flesh Indy out and make him human. His appeal is that he's the common man mixed up in extraordinary circumstances. You nailed it.
-
that there is a difference between unrealistic fantasy acceptable to the genre and completely fucking ridiculous cartoon bullshit like wild monkeys banding together for no reason to help a human fight Commies and showing him how to swing on a vine like Tarzan so he can catch up to vehicles going at full speed?
-
Surviving a nuke in a fridge is sillier than pulling out a heart with a bare hand and having someone live? You, sir, are a moron.
-
Humanizing a character doesn't weaken them. Be honest, you're 13 aren't you?
-
of my screen are mocking me. And ironically just a realistic as the ones in Indy 4.
-
No one wants to be lectured on hackery by your broken English. Indy's entire appeal comes from his humanity. Not his ability to leap tall buildings in a single bound. He cries. He bleeds. He feels. Also, your idea that Indy somehow is motivated by the goodness of his heart or something is ridiculous. In Raiders he goes to rescue Marion (personal interest). In TOD he goes back for fortune and glory. Saving those kids wasn't his main goal. It was just something that happened along the way. In LC he eventually has to save his dad. It's ALWAYS been personal for Indy. You obviously have some major psychological issues to work out with your own family, but don't let it affect your enjoyment of a film.
-
Great I just love those kind of movies. And I have a great idea for INDY 5 there is no MCGuffin, but only deepest survival and family protection. Ford is very good in that. Indy and is family are hanted by ghosts of the Nazi past. TOTH, Dietrich and Bolosh, oups Belloq :) Seriously !
-
Lets hope this, unlike Indy, actually gets made!
http://www.empireonline.com/news/story.asp?NID=25098
-
Because you're entire interpretation of the character is flawed. But answer something: Did you like 'Die Hard'?
-
That wasn't an answer. Should I rephrase?
-
If you're still around. PEANUT BUTTER CHILI DOGS! PEANUT BUTTER CHILI DOGS! All weekend long, brother!
-
Yeah, I suppose it was competently put together, but it was still really awful. For me, at least, it was one giant misfire. It actually made me feel a little sad how off and clunky and spastic retarded it was. In terms of attempts to revive olde franchises, I think it was MUCH worse than The Phantom Menace. Of course, like everyone, I really love Raiders, and thought the other two were okay / fun, but this last one? It was just bad. It was nonstop Jar Jar.
-
having issues to work out with your family explains why you have continuously spit vitriol towards people with "daddy issues" and see that as a weakness. You constantly mention it. So it has everything to do with what we're discussing. Try and keep up.
-
No matter what you think of Skulls, Raiders stands as the classic, and the sequels are just that....sequels. One day I wish some director would make a great movie in this genre, and walk away and let it stand on its own. But $$$$$ always fucks that up.
-
I think most of us agree that the only truly magnificent Indy film is Raiders. The other two people disagree on, but LaserPants has it right when he says they were fun...they're both highly amusing and clever.
Quite frankly, this is the problem with Indy 4. If it had just been fun and a rousing piece of flawed entertainment, hey, fine. I would have given it a pass 100%. If the film had had more stuff along the lines of the motorcycle chase in the college or the Indy/Mutt fight in the caves with the grave guards. That's passable fun and would have been totally fine if the story had a larger point to it.
So when we say we want the filmmakers to do better, we're not being nitpicky. All I want is to not have to cringe when I see something. I don't want to feel embarassed to be there. I don't want to raise my palms to my face, "oh, man, this is awful!". That's all I ask, and yet thi sis where Indy 4 failed miserably. They could have delivered a mildly amusing adventure that didn't quite measure up but was fun, or okay. Instead, they deliverd so many cringeworthy scenes that you felt bad as a viewer. -
1) No. You didn't answer. You just responded with questions. I'll assume you want me to rephrase. Here goes: Did you enjoy the film "Die Hard" in any capacity?
2) Bashing the fuck out of people with "daddy issues" says volumes about your psyche, whether you like it or not. -
If you'd answer the fucking question I can determine if there's a point to make or not. Do you remember the question? Want me to type it a third time? It's a few above this if you want to go back and reread. You claim that what you deem "daddy issues" take away from Indy's character. You can't spin it now. We all read it. There was a clear story to LC. Maybe you're too daft to grip the extreme complexities of the film. It's really hard to follow.
-
Although I can understand loving a film franchise, the hatred against individuals like Lucas, Spielberg, Shia.... it's really disturbing. These are just normal people living their lives trying to make entertainment. Sometimes it works, sometimes it falls flat, but to take a personal hatred in these people, to actually dislike them for the creative choices they make, and then wish upon them death or physical pain, it sad, pathetic, and makes me wonder if the posters here actually enjoy movies or just like to hate stuff. Seriously.
Now to the topic at hand, I thought the beginning of KOTTC was great, funny, fast-paced, and had tons of potential. I think they did a great job of passing the baton to Shia. And I had no problem with the UFO concept, because in the 50s that was a big deal. Makes total sense that an adventure, B-style movie set in the 50s would be about commies and UFOs... it is cinematically correct. The execution just wasn't that great, and for that, I blame the over-use of CG affects, and Lucas' unfortunate 180 on what he used to be about: character over spectacle. It was long, and a bit tedious.... but it was still Indiana Jones, and was better than a poke in the eye with a sharp stick.
I for one, think there is ENORMOUS potential with a "Mutt Jones" type trilogy, with Indy as the wise teacher ala Obi-Wan in ANH. It could be great to see this new character change with the times, and although it isn't Indiana Jones, it is still of that Universe and people should have a bit of an imagination and not close themselves off to change. No one has seen Indy5 and therefore no one can judge it..
And once more to the people who have a genuine hatred for Shia, Lucas, Spielberg, or any other entertainer out there who is actually doing something with their lives, please realize the enormous amount of personal time you are wasting, and how you are getting older every day. Just like Harrison said "Ain't getting any younger". Get a genuine life, and let the people who love film and imagination discuss this stuff with the grownups. Lates.
-
I'm sorry but Harrison Ford is just too damn old to be kicking the shit out of multiple soldiers more than half his age. Also, shouldn't Indy lose an eye in this one a la the tv show spinoff which showed him as an old man with an eyepatch? Btw, for me it goes ROTLA>LC>TOD>KOTCS
-
I love to enjoy a good Indy flick, and then come here and read all the autistic cry babies, piss and moan about why it sucked and raped their childhoods. "" P.S. "Personal Motivations" for a character is the height of character writing, altruism is not.
-
As I'm sure you've noticed, the more AssimovLives gets flustered, the more attrocious his English becomes. And he probably doesn't want to answer your DIE HARD question because he senses you've got a well thought-out response already cocked and loaded.
-
I understand what you're getting at with regards to the more disturbing forms of hate found on this site. No director, writer, or actor genuinely deserves it...and these guys can't always knock it out of the park every single time they pull a film together.However, that being said, INDY 4 was truly a piece of shit.
-
Why, you've already completed that mission, Assimov!
-
You're not stupid, Assimov. You're just not as smart as you think you are. Oh, and you can be quite the pretentious bore.
-
On the contrary, my point hinges on your opinion of Die Hard. As you may surmise, that's why I've asked you upwards of four times. Mr. Nice Gaius: Congrats on taking your first steps towards becoming "the most stupid creature in all creation", as told by a guy who thinks Indy loving his father makes him "much less heroic". Well played, sir.
-
Thank you, sir."...a guy who thinks Indy loving his father makes him "much less heroic"."Boggles the mind, doesn't it?
-
The best Trek after Wrath of Khan
The problem with GC effects is it's too much of a good thing. Everyone can do it now. The reason the earlier films worked better is because the filmmakers were forced, by the limitations of what they could do, to focus on the acting and the script to make the films better. The original SW movies are good not because of the awesome imagery... but because the characters and the conflict they were in was interesting. The FX were secondary.
Then along comes CG and the floodgates are opened, and now they can do whatever the hell they want and in that excitement, they forget about what audiences really connect with: characters and story. Lucas used to preach this back in the day but unfortunately he got "high" on the ability his new powers gave him treated actors and story like something that was in the way of all the ships firing at each other. Maybe some of this rubbed off on Spielberg too. This is the same guy that made Minority Report.... he has the ability to make a good film with strong characters and plot even while not being distracted by CG FX, which were impressive. .
To me, CG is like watching your friend's band do a tweny-minute prog-rock jam with zillions of guitar solos and drum-fills. It's self-indulgent. It's fun for the creator, but has nothing to do with what the audience actually wants, a catchy melody, something they can sing along and dance to. -
The second-highest grossing film of 2008- apparently you miserable cunts didn't like it, what else is new?
The movie had some dumb jokes, but it was a still a blast, IF you allowed it to be and it's no more absurd than the three before it, so fuck off and die...BRING ON INDY 5! -
That was a good example of the proper balance between script, acting, CG, not to mention the mixing of different genres. Unfortuanately I don't think many people saw Outlander.
-
Anyone seen DREAMSCAPE?
It's kinda a obscure sci-fi flick with Dennis Quaid... but it also features Kate Capshaw doing rather naughty things on a train. I guarantee those melons will make you forgive Willie her incessant screaming... -
Good grief....
-
...email me when you have a chance. dannyglovers.dickblood@gmail.com
-
...He'll NEVER answer your question. Way back when he was known as BladeRunnerUnit and Memories-of-Murder he was notorious for ignoring questions he couldn't answer. He pretends to want to have serious discussions about films but only responds to people who agree with him or until he realizes the person he's dealing with will pound his arguments into rubble.
Memories-of-Asimov's-Unit is a massive, massive tool. -
...through the motions doing uninteresting things for stupid reasons not even goats would eat it for breakfast during a dearth."
I thought Borat was from Kazakhstan and not Portugal... -
Go fuck yourself. That is all....
-
He's so terrified of answering you that he's trying to second guess you without forcing his hand. What a chickenshit bitch.
-
Everyone knows who you are. Denying it is just making you look stupid.
-
I was skimming the posts.....but MoM was saying LC's daddy issues ruined it for him.....does McClane have daddy issues I don't know about? The only thing I do know is that Len Wiseman can eat a fucking dick.
-
I, along with most people I know enjoyed Indy 4 very much. Have you not seen the crap out there? Do you think a crappy movie would of made 800 million world wide?
-
The way Speilberg and company used to make other filmmakers look out of touch and past their primes in the late 70s...? For the first time that's how I felt about Speilberg watching Indy 4. His tricks looked old, the jokes weren't funny, the effects were awful, the music - as great as Williams' Indy march is - was the same old same old, and now they seem intent on compounding the problem. Like Lucas did with the prequels. Or maybe they just all sense one last killer payday. (Except for Shia, who's got plenty of killer paydays for dreck like Transformers 12 in front of him.)
-
Pointless fun. I welcome a 5th with open arms.
-
Other than the Tarzan sequence and the (spectacular!!) ending of KOTCS I didn't see that much outlandish CG. If anything I thought the movie felt like it was shot on somewhat claustrophobic studio sets (which is exactly right for this type of movie genre). I wouldn't have a problem with a "Mutt Williams" franchise provided it's NOT called "Indiana Jones" (or "Indiana Jones, Jr."). We need more of these classic old fashioned action serial tales in our theaters not less! Otherwise it's an endless parade of shakey-cam, hypercut bullshit.
-
You will discover that the majority of the effects were models. Same with the PT. The PT actually used more model work than Greenscreen
-
Jun 19, 2009 11:45:19 PM CDT
indiana jones and the tomb with his name written on it
by gabbo_the_great
-
Loved that shit when I was a kid.
-
Look, I spent a good 12 years growing up reading comics, specifically X-men and prayed that they'd make movies one day. The Wolverine movie made me regret it. The first 2 Star Wars are complete garbage (Ok I liked the last one).
I just got out of Up with the kid not long ago and realized any true creativity lies in new fresh stories ahead.
Indy 4 brought me physical pain. It was like going back to elementary school and see that they are selling drugs there now. It robs you of something deep down. And I'm the fucking target audience. That's the worst part.
Indy 4 was so bad I'm done with all remakes and rehashed. I'll watch Transformers 2 but no GI Joe. You can count me out on any non Iron Man related Marvel movie because that earned something at least. I'm done.
Fuck Indy 5. I hope the reel cuts to obese people bestiality porn for a good 20 mins during the movie so more people write it off. Even then it'll get 20% on RT. -
It's for the children
-
Its not for the children. Its for us. Us older folk trying to recapture a part of our youth. Lucas has NO excuse. He owns he own production company to avoid input from soulless executives only to show he's got less of a soul then they do. My kid couldn't pick Indy or Luke Skywalker out of a crowd. It's meant for us and its a colossal failure. You want for the kids: Miley Cyrus, Jonas Bros and Wall*E. These kids grow up on this now.
-
The movie was horrible, and most people seem to forget it as soon as they leave the theater.
-
SWEEEEEETTT!!!
-
All the question asked was if you enjoyed the film. If you honestly think that the Die Hard franchise has no more in common with Indiana Jones than The sound of Music, you're an idiot. I digress. Your arguments have been invalidated and you're just arguing for the sake of arguing. The point being is that you're wrong in your characterization of Indy as somehow weakened by the relationship with his father. So why don't you go ahead and stammer out your archaic, repetitive, retort. It's not going to change anything. You've shown your cards. You're a hypocrite and your understanding of film is sketchy to say the least. Give it up.
-
You've got to be kidding me. Pixar can make you feel for a character whose dead for 90% of the movie better then anyone who dies at the end of a movie. Up was fantastic.
-
People who legitimately think that there isn't a soul on this TB who will skip Indy V based on the latest installment are fucking assholes. I guarantee that I won't see it, and I'm sure there are others who won't either. Fuck off, assholes. If you want to see it, that's fine. But don't assume that everyone else is a slack-jawed idiot just because you are.
-
I call BS you cried during UP. I bet you were bored during it and couldn't wait to get out of the theater.
-
Jun 20, 2009 3:20:34 AM CDT
I promise I will not pay to see Indiana Jones 5.
by dannyglovers_dickblood
I will watch it when it is on cable, but I refuse to contribute another cent to this franchise after horrific pile of shit that was 4.
-
Usually whenever they say something like that the movie eventually turns out into shit. Just like the Oceans 12 gang were having so much fun too!
-
I'd pay to see that storyline. (Though it would just end with some lame ass shot handing the franchise over to Shia like it almost did in INDY IV with the picking up the fedora in the church scene.
-
Well-made points, but I disagree. People seem to think that a cop doing his job is enough for a film. It isn't. There has to be an emotive arc to tie in with the internal dilemna. If there isn't, you wind up with crap that doesn't resonate.
-
Again, you make good points. But without that personal connection, the character has no arc. It's just 'save the day.' Which works in a serialistic property, but in a mainstream film there needs to be an arc for the main character to face. The right thing to do is dull to watch and write if you're aiming to have people care about the character on a truly emotive level.
-
YES, the relic for the next Indy film should be Muhammad's sword. There should be a room filled with the skulls of infidels... Indy has to pick the right one to open the chamber to Muhammad's sword. He then fights an army of Russians.
-
is just a close-up of Shia's ass farting for 90 minutes. Plus aliens
-
http://tinyurl.com/lghwdn
-
At the time, I thought I accidentally walked into Lethal Weapon 4.
Die Hard 1&2: terrific
Die Hard 3&4: shit -
You're still the same disingenuous, cowardly turd you've always been. You accuse kolchak of wanting to start a fight, when you CONSTANTLY allude to the fact that if someone doesn't agree with you about J. J. Abrams or Michael Bay that they're complete morons. You are CONSTANTLY baiting people and trying to provoke shit. The funny thing is, when someone actually does step up and say "fuck you, I'll sort your shit out" you swiftly backpedal and act like a mewling victim while cowardly refusing to engage in the debate. Your hilarious responses to kolchak prove this beyond any doubt. You refuse to answer his question officially, but try to second guess what his sucker punch is going to be. You're too chickenshit to engage in straight debate because all you spout is tired fucking soundbites and buzzwords which you CAN'T FUCKING BACK UP.
Oh, and I find it insulting that you think that your English "fingerprint" is so flawless that we can't figure out that you're BladeRunnerUnit and Memories-of-Murder. Your arrogance regarding your tenuous grasp of idiomatic English is truly staggering. -
This time, they'll just tell you about the stupid ending right off the bat.
-
Can't argue with that kind of worldwide gross. They're all getting old and need a couple more of those for retirement plan. Also, I'm sure Shia is fine enough person, but I do not like him as an actor, period. I'm not even saying he's a bad actor. Sometimes that doesn't matter. Sometimes certain actors just totally turn you off no matter how good they are. He does that for me. Him and Shirley MacClaine. So if it were possible to have LESS interest in the next Indy film than I already do, him being cast as the lead would be the cause.
-
You're a moron because your entire point revolves around personal interest cheapening Indy when that's ALL INDY HAS EVER BEEN INTERESTED IN. Indiana Jones is a thief. In Raiders he went after the ark because they had Marion. In TOD he went back to get the stones for fortune and glory. In LC he had to rescue his father. He was never the hero you made him out to be. If you like Die Hard, you're a hypocrite because the character of John McClane is marred with what you might call "wifey issues" or whatever the fuck your 13 year old brain can come up with. But again, Indiana Jones is not and has never been a selfless hero. He's always had a personal stake. You claiming that he hasn't makes it seem like you didn't even watch the movies. You have no idea what you're talking about.
-
You're a moron because your entire point revolves around personal interest cheapening Indy when that's ALL INDY HAS EVER BEEN INTERESTED IN. Indiana Jones is a thief. In Raiders he went after the ark because they had Marion. In TOD he went back to get the stones for fortune and glory. In LC he had to rescue his father. He was never the hero you made him out to be. If you like Die Hard, you're a hypocrite because the character of John McClane is marred with what you might call "wifey issues" or whatever the fuck your 13 year old brain can come up with. But again, Indiana Jones is not and has never been a selfless hero. He's always had a personal stake. You claiming that he hasn't makes it seem like you didn't even watch the movies. You have no idea what you're talking about.
-
Browser flipped out. But AsimovLives can use the double post to practice sounding out words.
-
Jun 20, 2009 10:31:28 AM CDT
"use the double post to practice sounding out words."
by mr. nice gaius
-
"Personal attacks"? All you fucking do in your posts deriding certain movies and directors is say how anyone who might disagree with you is an idiot. That's the very definition of a personal attack. I love how you tell kolchak to either end the personal attacks or consider the conversation over. Do you even realize how hypocritical and cowardly you sound, you sniveling, slimy little shit?
The sooner you get banned again the better. -
You don't "share your opinions" of movies. You simply DECLARE what's good and what's shit and call everyone who disagrees with you an assortment of terms describing them as being less than bacteria -- that is, until one of them calls you on it, in which case you bitch out, big time.
-
I already made my contributions. You just didn't read them.As for the "POWER OF BAY COMPELS YOU!" gag, do you know how many running gags there are on this website at any given time?!?!
-
...sometimes AICN Talkback is just as much about the Talkbackers as it is the topic at hand. If you haven't figured this out after all the time you spend on this site, then there really is no hope for you.
-
What is it you contribute to the talkbacks again?
You spend your time on AICN furiously posting masturbatory hate tracts about Bay And Abrams in non-Bay and non-Abrams talkbacks. If not that, then you're either declaring the "truth" of movies and issuing blanket personal insults to everyone who disagrees. On occasion you find someone who actually agrees with you at which point you begin a truly sickening, repellent campaign of toadying and sycophancy which puts everyone else off their lunch.
You're simply an arrogant, repulsive tool with a severe inferiority complex. -
"By the way, is Indy really a thief?" Yes. remember the cross of Coronado? Indy certainly has an affinity for these relics and getting them to a museum, but it's just not his #1 goal. To say that Indy went after glory but not fortune is to ignore arguably one of the most famous lines in the picture. What was it again? Oh yeah: "Fortune and glory, kid. Fortune AND glory". Perhaps Indy misspoke? Surely you know him better than the people that wrote him, right? The character of Henry being parallel to the grail is no different that Marion being parallel to the ark or the children being parallel to the shankara stones. So, really, the only time Indy has gone out of his way to be selfless was TOD. I'll give you that. All other times he's had a personal interest. So saying caring about his father gives him daddy issues and makes him weak you'd HAVE to say caring about Marion makes him equally weak. The ultimate point is that Indy's humanity defines him as a character. It's the defining theme of the franchise and, indeed, LC. And to even put it further, Indy didn't truly have issues with his dad. He loved his dad. But Henry is a perfect example of fathers from that time period. Stony, seemingly uncaring, and strict. It's an important film because Henry's callousness is what drove Indy to become that man he was; the man with the aforementioned drive to prevail. He wanted to please his dad. Without Henry, Indiana Jones might never have been and Henry Jones Jr. would have become a dentist or something.
-
This isn't a court of law, you putz. You've been here long enough to know that all posts get deleted if someone is banned. I'm not trying to "prove" anything. Everyone who remembers you can tell who you are. I know for a fact that others have called you on your identity in talkbacks. A coincidence? Yeah, uh-huh.
-
What. A. Little. Bitch.
-
Also, just to toss myself into the debate about whether or not you've been banned before, I think the "proof" you're looking for would be your handle. Someone named Memories-of-Asimov's-Unit gets banned and then someone named Asimovlives appears. Doesn't that count as fairly damning evidence?
-
You are the talkbacker formerly known as BladeRunnerUnit and Memories-of-Murder. For a normal person there would be no shame in admitting this. Most banned talkbackers readily admit having been banned. You, on the other hand, have such an inflated sense of ego that you simply cannot abide admitting the truth.
-
I must want gay porn spammed to me. Perhaps I've said too much. Praise Bale!
-
It's not that he can't admit it. He hasn't gotten that far into the hooked on phonics program, and thus, doesn't know what to type that. All of that good stuff aside, Indiana Jones 4 was sub par. Indiana Jones and the Last Crusade was, by most accounts, a perfect ending to the franchise.
-
Jun 20, 2009 1:50:56 PM CDT
DocP - why was M-O-M banned, other than being a jackass?
by toadkillerdog
Yeah, he was a condescending know-it-all who did not know as much as he thought, but I never saw him as a real troll, just a dick hole.
-
just adapt the fate of atlantis plot to the big screen and make the indy movie i have wanted for the last 15 years.
-
Directed by JJ Abrams.
-
I personally don't see that movie as portraying Indy as a guy with daddy issues. He was estranged from his father for years, yet he still went after him when he knew he was missing. Someone that detached from their father still goes after him when he turns up missing? If Indy truly had daddy issues he would have been conflicted about if he should go after him or not, or might not even have gone after him at all. I know people who are estranged from their fathers and they could give a shit less if their fathers disappeared, in fact they might even welcome it. Sad, but a fact of life. So Indy has a problem with his father, so what? Who among us has a perfect relationship with their father? It is clear that Indy and his father unconditionally love each other despite their estrangement. That does not scream daddy issues to me at all. I also don't see it as diminishing the character of Indy. That is of course my opinion. Asimov, I know you will disagree with me on this and that's fine as I always welcome different opinions, it is what makes us individuals, and I can see you have been having problems with other people in this TB. I personally don't care if you are or are not someone else who has been here before, it really doesn't matter in the grand scheme of things. I would like to point out one thing and don't get offended as that is not my intention. Your opinions have a tendency to come across as absolutes, as cold fact. I see you as strongly opinionated but I can see where other people can be rubbed the wrong way. Either way, you, I, SAG,SDB, we all present different opinions and make for some good bantering back and forth, so I welcome the debates. I may not always agree with you, in fact I think you and I disagree more than agree LOL. But that's fine, you have never bugged me enough to make an issue out of it. So I say, whatever, opinions and debates make the world go round, so carry on!
-
Although Memories-of-Asimov's-Unit's tireless pimping of his Abrams/Bay hate in virtually every talkback he partakes in is a classic case of trollism, you're right -- he's more of a straight-up dick hole.
-
I watched Indy IV the other night and i enjoyed it quite a bit, but the first time i f'ing hated it. I dont know maybe i had higher expectations the first time. I thought to myself, you know if i think about it, all the Indy movies are cheesy and over the top in their own way, so whats the big fucking deal. This movie was damn entertaining. I have also realized over the years, as i get older, that i hate going to the theaters to watch movies. Everytime there is someone that annoys the fuck out of me, and ruins the movie for me. But thats another issue...
-
The movie follows Jones' worldwide search to find the keys to his pickup.
-
I see you've been reduced to using the plant defense -- you know, when plants will say: "oh, so just because I like a movie I'm a plant?!?"
Your "What, there's only one person online in the whole of Portugal?" is a perfect example of that.
No, dipshit, it's not simply because you're Portuguese. Let's do the math again, shall we? How do you rate the odds of THREE different people sharing these exact same characteristics:
1) From Portugal.
2) Has an obsessive love for Blade Runner.
3) Likes to describe himself as a true expert on hard SF, and is particularly fond of Asimov.
4) Produces long-winded and condescending posts on the physics of nuclear explosions and supernovae.
5) Posts lengthy and repetitive rants on his hatred for Michael Bay and JJ Abrams in almost every talkback.
6) Is very condescending to Americans.
7) Has a serious hard-on for South Korean cinema.
8) "Debates" consist of declaring what's wrong and what's right, calling everyone who disagrees a moron yet refuses to counter any argument put forth by "morons" who dare to defy him.
9) Posts creepy, awkward, asexual facsimiles of what he thinks it's supposed to sound like when talkbackers talk about sexy women in films. Very creepy.
To top it all off, all the above-mentioned posts are written in THE EXACT SAME GODDAMNED STYLE OF GARBLED ENGLISH AND POOR GRASP OF IDIOMATIC EXPRESSIONS.
Three different people? If three different Portuguese people happened to wander into AICN and sport the exact same constellation of characteristics it would mean that virtually everyone in Portugal is the same way (God help them). Apply Occam's razor to the equation, however, and the most likely answer is: it's the same douchebag.
Simple. Fucking. Math. -
...both M-O-M and AssLives also have a boner for Rob Zombie and defend the idea of psychologizing Myers.
-
...the fucking crying about perverting your username? It's okay for you to say "Bayformers" and "Gayformers" and "JJ Merda Abrams", but you can't take it yourself?
Jesus, could you be more of a whiny little bitch? -
I just saw the comment about Zombie and Myers and had to comment myself. I liked Zombies version, but I do agree that giving Myers a reason to murder, making him more "human" definitely makes him less of a evil murdering machine and more of a pissed off son/stepson/brother. Sure he is still a brutal killer, but giving him humanity just makes him less of a monster to me.
-
My point is that it's yet another thing these supposedly different people have in common.
-
Oh I understood the point you were making dude, I just wanted to comment on it anyways.
-
Watch me Thuggats!
-
That ALONE is grounds for dismissal. Of all the talk of hacks that has gone on in this thread, Zombie is BY FAR the biggest.
-
to start Indy 5 with an exciting chase scene, straight off the bat? That's what made KOTCS not feel like an Indy film IMHO
-
Asimov, the bottom line is that everybody here disagrees with your notion that personal stakes somehow "cheapen" characters. You're arguing against a long-held and long-treasured truth of storytelling because for whatever reason, you've latched onto this warped (and highly subjective) notion of detached heroism for heroism's sake. If everyone here disagrees with you...is there maybe just the slightest possibility that you're mistaken? That you've missed something? That you don't know enough about narrative and character? The point is hardly even up for debate, nobody agrees with you. I don't doubt that you passionately believe in your point but it stems from a flawed sensibility you picked up somewhere...it's a twisted argument that has no truth to it.
Ask anyone who is a professional writer, a tried and true storyteller. They will tell you the same. No one writes effectively the way you suggest. Study the craft, read some books on it and you will understand. At the level you're at, it's obviously impossible to make you understand...maybe you're just stubborn?
The idea of a "cool hero" is something out of cheap teenage fantasy. It doesn't apply to the great stories, and it certainly doesn't apply to Indy. I think part of the problem is that you're starting out from a mistaken perception of who Indy is. You've projected your own ideas onto him and this don't understand the character. He was never supposed to be a "man of mystery", a "cool hero with mystique". That's off the mark by a mile. Yes, he has swagger, yes he has attitude...but the key to Indy is that he's human. He's vulnerable. He howls in pain. He sometimes ends up looking stupid. He's petrified of snakes, for God's sake! He's a bookish professor. He certainly isn't the boring, archetypal hero you speak of. Now THAT'S banal.
-
What was so unique about Indy Jones was that he was so relatable, i even posted before that unlike James Bond or Han Solo who had a bunch of cool shit and gadgets, Indy just had a freakin whip and his own revolver. He's even more realistic than Batman since he isn't a millionare or didn't train in athletics or fighting methods.
-
I'd give this a shot. Seriously though, Indiana Jones is a dead horse, and a dead horse over 6 decades old, at that.
-
Short-round was raped and killed. Raped and killed! That no cookie.
-
once misstep and everyone pounces
-
So this is just a trifle, an insignificant detail...a misstep. Listen, we waited 18 years to receive a film that wasn't merely flawed...it had disastrous lapses in judgment, horrible narrative and production choices, and was deemed an overall letdown by audiences. Yet it's somehow unfair if "everyone pounces"? Grow the fuck up - if these filmmakers can't get their act together, then we certainly have the right to express how lamebrained the film is. Spielberg should have known better than to hire Koepp, with his track record.
As I said in the Transformers 2 thread, the term "hater" is a gross simplification - it's a bullshit way of trying to reduce your opponents' viewpoint into something you can understand & easily revile. Do you think I want to hate on Indy 4? No, I want to love the fucking thing. I want to be excited, I want to laugh at the humour, I want to feel the tension and follow the action. I don't want to put my palms up to my face in embarassment when I see Shia swinging from the vines, ok? And I don't hate Shia; he's a competent young actor with presence. He gets criticized because he's an easy target, but he's fine in my book...the blame lies solely with the two filmmakers.
Unfortunately, those who loved the film belong to the lowest common denominator: the fratboys, the undiscerning teens, and yes, the retards. This isn't about blind hatred, it's about a love of storytelling and a love for the experience of going to the movies.
So a better distinction would be:
a) People with standards & an appreciation for storytellings.
b) Retards.
Ok, ok. Maybe not retards. But definitely, "Members of America's cultural underbelly with crude, simplistic tastes and marginal complex thought." Or, "Folks who use hollow rationalizations to settle for less." Or maybe, "People who didn't read a whole lot when they were younger."
Maybe this means you, Orcus? Huh? -
All the movies have over the top elements, you walk in expecting this, not high art. The problem here was that it was too over the top. So yeah mistep, now they know to pull things back a bit. Jeez, in Temple of Doom it was the mine cars jumping over the tracks and guys getting their hearts pulled out and living. If it came out today folks would whine about it to high heaven.
-
Seriously! I don't know what happened to George and Steve but they're not the same men they used to be when it comes to filmaking. They've lost their "edge" or something....Maybe it's that they've mellowed with age. I don't know.....All I do know is that Indy's a fantastic character and the last thing we need is for the series to continue down the road the Crystal Skull setup....Mutt? I didn't dislike him and I thought Harrison and Shia had good chemistry. That doesn't mean I want to see more of it. Marion, good lord they lobotomized her in the last film. I feel bad for Karen because she truly looked excited to be back. I just wish they would have given her more to do except drive a fucking Russian duck off a cliff and look dumbfounded....It's ironic because some of the best dialogue in the film was the one or two exchanges between her and Indy.....I just don't want another Indy movie with GL and SS involved...unless they're just producing it. I just don't trust them anymore when it comes to handling the character. I'd rather see the series go back to it's 30's "serial roots" or just not make anymore. I'm not against them casting a "new Indy" either. Harrison will always be Indy to me but that doesn't mean the character has to "retire" with him.....Sean will always be James Bond but we've gotten some very cool Bond films since he left too....I never thought they'd be able to replace the original Star Trek crew but JJ did it and I LOVED the new movie. So, it IS possible....
-
Jul 04, 2009 1:42:55 AM CDT
Indiana Jones and Forget the Fourth Film Ever Happened
by det. john kimble
In this film, Indy searches for George Lucas' lost credibility.
-
I hated indy 4. i found it as a slap in the face to all the indy fans out there. but i think it could be worse i mean they could go back and re-release the originals with "new deleted scence" like they did for a certain trilogy. as well as release these new ones with bad acting. i think its best to look back and say well yes indy 4 sucks but at least i can go back and watch raiders and not have to worry about bullshit scenes that were never needed. i say bring on indy 5 just go back to nazis the occult and NO MUTT!
-
For HD Broadcasts of Raiders, one scene was redone namely the chase scene where Indy forces the Nazi off the road and over a cliff. It's real subtle and not distracting. BTW don't be so pretentious as to speak for all Indy fans
-
well atleast its not a complete change in the scene like what they did in episode iv. though i could be wrong i dont like this redo stuff. editing a little here in there to help clean up the effect i dont mind i mean im talking changing scenes like they did in star wars. on my comment on the slap i found that most fans that i have meet found it almost like what south park found it. but i do agree i did jump the gun a little bit on that. i apologize. i hope that lucus has learned from star wars and wont change the originals. but only time will tell
-
The only REALLLYY good redo in Ep4 was the battle of Yavin. It just flowed. That and TESB with the Bespin scenes were just stunning.
-
The best action scene in the movie was the motorcycle chase. And you know that many Indy fans were greatly disturbed by the product. It was missing that 'magic' of the previous three. Yes, all of them have over-the-top stuff in them, but the others didn't have such blatant use of CGI which really took away from the movie.I want old school Indy, which probably is impossible now due to Ford's age, but still....
Readers Talkback
User Login
Top Talkbacks
- To Commemorate The 3D Release Of STAR WARS EPISODE I: THE PHANTOM MENACE, George Lucas Wants You To Know...Greedo Shoots First!! -- 425 total posts 425 posts
- Quint travels to Barsoom and visits the John Carter set!!! -- 125 total posts 94 posts
- SPACE 2099!! -- 155 total posts 79 posts
- Rest In Peace Bethesda’s Adam Adamowicz -- 70 total posts 70 posts
- There's a STAR TREK video game that is going to lead into JJ's STAR TREK 2 apparently... -- 67 total posts 67 posts
- Friday Brings SWEEPS DAY NINE!! Gab Here About Tonight’s FRINGE!! Plus Einstein on TIM, Wiig On PORTLANDIA, MAHER, CLONE, GIFTED, GRIMM, SPARTACUS, SUPERNATURAL, GOLD RUSH And More!! -- 86 total posts 66 posts
- The Sensorties Revisit The Friday Docback (And Still Smell)!! DOCTOR WHO Story #7 Again, The Coming Of Season/Series 7, And More!! -- 65 total posts 65 posts
- AVENGERS enemy revealed as pink boardgame pieces... You might suffer some form of elation... SPOILERS!!! -- 57 total posts 52 posts
- Ridley Scott's Next Will Be Cormac McCarthy's THE COUNSELOR! -- 48 total posts 48 posts
- Wanna smell like the Hulk? What about Cap? Consider yourself a Thunder God or a unisex God of Mischief? -- 45 total posts 44 posts